Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W4T7

Protein Details
Accession A0A4P9W4T7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-92SAANPDGRSRPRRRPRPHRLLPLAHHKBasic
NLS Segment(s)
PositionSequence
72-114GRSRPRRRPRPHRLLPLAHHKLARKSHHGKPLARPRFRRRADL
Subcellular Location(s) nucl 12, mito 8, extr 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MAPHQQRCTFSRVGMIFQSLAISFDIEHFVANHPQDHLLIEHEHGGRPHRLPTNHQALRQHPLLLSAANPDGRSRPRRRPRPHRLLPLAHHKLARKSHHGKPLARPRFRRRADLARLRNRTITGFEPDLLSGTDLAQIASIVSRLEYLRLPDNAWDAVLVNSHTEISPAMQYWAPASYYSAGEITITSLPRLEFIQFPYLGDEAPKLSGPFMHMLASLRPPLRYVSLIGSHLPSEDLLANLLAACPTIEDLNLIICRNLTNETLTALQTHPPLHRLSPSHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.26
4 0.24
5 0.24
6 0.16
7 0.15
8 0.12
9 0.1
10 0.08
11 0.09
12 0.12
13 0.1
14 0.1
15 0.1
16 0.13
17 0.18
18 0.19
19 0.2
20 0.19
21 0.2
22 0.2
23 0.2
24 0.18
25 0.15
26 0.15
27 0.15
28 0.19
29 0.19
30 0.2
31 0.2
32 0.24
33 0.26
34 0.26
35 0.32
36 0.34
37 0.35
38 0.4
39 0.48
40 0.55
41 0.54
42 0.57
43 0.56
44 0.52
45 0.55
46 0.5
47 0.43
48 0.32
49 0.3
50 0.26
51 0.21
52 0.18
53 0.14
54 0.15
55 0.14
56 0.15
57 0.14
58 0.18
59 0.25
60 0.34
61 0.39
62 0.48
63 0.57
64 0.68
65 0.78
66 0.84
67 0.88
68 0.9
69 0.92
70 0.92
71 0.89
72 0.85
73 0.8
74 0.8
75 0.74
76 0.66
77 0.6
78 0.52
79 0.51
80 0.51
81 0.51
82 0.49
83 0.5
84 0.54
85 0.6
86 0.64
87 0.61
88 0.64
89 0.7
90 0.7
91 0.71
92 0.72
93 0.72
94 0.76
95 0.74
96 0.71
97 0.67
98 0.67
99 0.69
100 0.71
101 0.72
102 0.71
103 0.73
104 0.67
105 0.62
106 0.53
107 0.44
108 0.37
109 0.29
110 0.23
111 0.2
112 0.18
113 0.17
114 0.16
115 0.15
116 0.12
117 0.1
118 0.06
119 0.05
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.06
134 0.08
135 0.11
136 0.12
137 0.12
138 0.12
139 0.14
140 0.13
141 0.12
142 0.1
143 0.08
144 0.07
145 0.07
146 0.07
147 0.05
148 0.05
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.08
159 0.08
160 0.09
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.1
167 0.09
168 0.08
169 0.07
170 0.07
171 0.08
172 0.09
173 0.09
174 0.08
175 0.09
176 0.09
177 0.1
178 0.11
179 0.11
180 0.1
181 0.12
182 0.17
183 0.16
184 0.17
185 0.18
186 0.17
187 0.16
188 0.15
189 0.13
190 0.09
191 0.1
192 0.1
193 0.08
194 0.08
195 0.09
196 0.11
197 0.12
198 0.12
199 0.12
200 0.12
201 0.13
202 0.15
203 0.17
204 0.19
205 0.18
206 0.18
207 0.18
208 0.19
209 0.2
210 0.2
211 0.19
212 0.19
213 0.21
214 0.23
215 0.23
216 0.22
217 0.2
218 0.19
219 0.17
220 0.12
221 0.11
222 0.1
223 0.09
224 0.09
225 0.08
226 0.08
227 0.07
228 0.08
229 0.06
230 0.05
231 0.05
232 0.04
233 0.05
234 0.06
235 0.06
236 0.06
237 0.07
238 0.11
239 0.13
240 0.13
241 0.12
242 0.12
243 0.13
244 0.14
245 0.17
246 0.14
247 0.15
248 0.15
249 0.17
250 0.18
251 0.18
252 0.19
253 0.17
254 0.19
255 0.19
256 0.23
257 0.22
258 0.24
259 0.26
260 0.27
261 0.33