Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399GFX7

Protein Details
Accession A0A399GFX7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSKELKNKRKAEKKAAEKAASEHydrophilic
NLS Segment(s)
PositionSequence
6-18KNKRKAEKKAAEK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSKELKNKRKAEKKAAEKAASEAEAWKSSSKTVLGRLTYRLKDLPDLQIIRVEFWSSKSLDENREVHTPDDYVRIYSRKHQEPAWKELLENAFLEYKDIAAINKKPVGRKHECHLIIPSHSIRNIRLGRYPPPDRISWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.8
4 0.71
5 0.64
6 0.57
7 0.48
8 0.38
9 0.3
10 0.24
11 0.22
12 0.22
13 0.21
14 0.17
15 0.17
16 0.19
17 0.19
18 0.18
19 0.22
20 0.27
21 0.28
22 0.29
23 0.34
24 0.39
25 0.38
26 0.38
27 0.34
28 0.3
29 0.3
30 0.31
31 0.29
32 0.28
33 0.28
34 0.26
35 0.27
36 0.26
37 0.23
38 0.21
39 0.18
40 0.12
41 0.13
42 0.15
43 0.12
44 0.13
45 0.15
46 0.18
47 0.19
48 0.23
49 0.23
50 0.24
51 0.26
52 0.26
53 0.23
54 0.21
55 0.19
56 0.15
57 0.17
58 0.14
59 0.12
60 0.12
61 0.14
62 0.14
63 0.21
64 0.28
65 0.3
66 0.32
67 0.35
68 0.42
69 0.45
70 0.51
71 0.49
72 0.42
73 0.37
74 0.39
75 0.37
76 0.29
77 0.24
78 0.19
79 0.14
80 0.14
81 0.15
82 0.11
83 0.09
84 0.09
85 0.09
86 0.08
87 0.12
88 0.14
89 0.18
90 0.22
91 0.25
92 0.3
93 0.36
94 0.44
95 0.48
96 0.5
97 0.52
98 0.58
99 0.57
100 0.55
101 0.53
102 0.48
103 0.42
104 0.43
105 0.4
106 0.33
107 0.35
108 0.34
109 0.3
110 0.36
111 0.38
112 0.35
113 0.39
114 0.39
115 0.45
116 0.52
117 0.56
118 0.54
119 0.54