Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399G9J1

Protein Details
Accession A0A399G9J1    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-160QHDRTKKGSKLSMRRLMRKLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF13424  TPR_12  
PF13176  TPR_7  
Amino Acid Sequences MYERALRGKEEALGVGHSSTLDTVNNLGLLYAAQGRLGEAEKMYERALRGYEALGSVRVQQYLPALNTLQNMGDLYAKRAESAKAREVYTRALSGLTSVLGASSERCMGLSAKIDVLPSASREDGGQLKPPTVGERPASQHDRTKKGSKLSMRRLMRKLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.11
5 0.1
6 0.09
7 0.09
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.08
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.08
24 0.09
25 0.09
26 0.07
27 0.1
28 0.11
29 0.12
30 0.13
31 0.13
32 0.13
33 0.14
34 0.15
35 0.13
36 0.13
37 0.11
38 0.11
39 0.1
40 0.1
41 0.1
42 0.09
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.11
49 0.13
50 0.13
51 0.12
52 0.12
53 0.12
54 0.12
55 0.12
56 0.11
57 0.08
58 0.08
59 0.07
60 0.09
61 0.08
62 0.09
63 0.11
64 0.11
65 0.11
66 0.12
67 0.13
68 0.15
69 0.19
70 0.22
71 0.23
72 0.24
73 0.25
74 0.25
75 0.27
76 0.24
77 0.21
78 0.15
79 0.13
80 0.12
81 0.11
82 0.1
83 0.07
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.05
93 0.06
94 0.07
95 0.07
96 0.09
97 0.11
98 0.11
99 0.12
100 0.13
101 0.13
102 0.12
103 0.13
104 0.11
105 0.1
106 0.12
107 0.11
108 0.11
109 0.11
110 0.14
111 0.17
112 0.18
113 0.24
114 0.23
115 0.23
116 0.24
117 0.25
118 0.26
119 0.24
120 0.27
121 0.22
122 0.27
123 0.3
124 0.38
125 0.42
126 0.42
127 0.48
128 0.52
129 0.56
130 0.58
131 0.61
132 0.59
133 0.62
134 0.67
135 0.69
136 0.71
137 0.74
138 0.78
139 0.79
140 0.82