Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A399GDH7

Protein Details
Accession A0A399GDH7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 8, mito 7.5, mito_nucl 7, cyto_pero 7, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVVLDKQTNDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEANGQIKKVVGHSKLSIYTRAIGAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.42
16 0.4
17 0.34
18 0.28
19 0.27
20 0.25
21 0.29
22 0.27
23 0.25
24 0.23
25 0.25
26 0.29
27 0.32
28 0.33
29 0.32
30 0.34
31 0.33
32 0.3
33 0.28
34 0.23
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.14
56 0.12
57 0.11
58 0.13
59 0.16
60 0.17
61 0.17
62 0.16
63 0.15
64 0.14
65 0.14
66 0.16
67 0.19
68 0.2
69 0.25
70 0.27
71 0.31
72 0.36
73 0.38
74 0.37
75 0.32
76 0.31
77 0.28