Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399HPD6

Protein Details
Accession A0A399HPD6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-95SLENHSRATRRDRRPKRPGRTHTRRGPAVLBasic
NLS Segment(s)
PositionSequence
73-93ATRRDRRPKRPGRTHTRRGPA
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAVGQPQMAEFDHPQQRHTNECNESMNQSQVPGGNAQPQHDMMGGVQSQGANTSAASSSSSAMNPSLENHSRATRRDRRPKRPGRTHTRRGPAVLHHRSEVARH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.39
4 0.42
5 0.44
6 0.44
7 0.4
8 0.43
9 0.45
10 0.4
11 0.41
12 0.35
13 0.34
14 0.25
15 0.22
16 0.19
17 0.17
18 0.16
19 0.14
20 0.13
21 0.15
22 0.16
23 0.17
24 0.18
25 0.17
26 0.17
27 0.15
28 0.15
29 0.09
30 0.11
31 0.09
32 0.08
33 0.08
34 0.07
35 0.06
36 0.07
37 0.07
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.15
54 0.16
55 0.17
56 0.19
57 0.24
58 0.27
59 0.3
60 0.39
61 0.43
62 0.52
63 0.61
64 0.7
65 0.75
66 0.83
67 0.91
68 0.92
69 0.93
70 0.92
71 0.92
72 0.92
73 0.92
74 0.91
75 0.89
76 0.82
77 0.74
78 0.67
79 0.66
80 0.66
81 0.64
82 0.57
83 0.49
84 0.49