Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399HP55

Protein Details
Accession A0A399HP55   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ASKRLQQESFRKRKNNFLRRGHEISDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MASKRLQQESFRKRKNNFLRRGHEISDRYNVGVWLCIQKSNGQLYIYNSDPARPDWPPSSTQLETTYPVPIIKTSEDFLSKAPPPKKSPPATKNASLPGYLSRPPIPEYAQEEVFSGRLLGRRRDGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.82
4 0.81
5 0.8
6 0.79
7 0.78
8 0.8
9 0.73
10 0.7
11 0.62
12 0.56
13 0.52
14 0.45
15 0.37
16 0.32
17 0.29
18 0.21
19 0.19
20 0.17
21 0.15
22 0.15
23 0.16
24 0.16
25 0.18
26 0.21
27 0.23
28 0.24
29 0.2
30 0.21
31 0.22
32 0.25
33 0.24
34 0.22
35 0.19
36 0.18
37 0.18
38 0.18
39 0.18
40 0.15
41 0.17
42 0.17
43 0.19
44 0.2
45 0.22
46 0.27
47 0.24
48 0.24
49 0.24
50 0.22
51 0.22
52 0.21
53 0.18
54 0.13
55 0.12
56 0.11
57 0.09
58 0.1
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.13
65 0.13
66 0.16
67 0.18
68 0.24
69 0.27
70 0.31
71 0.36
72 0.44
73 0.53
74 0.56
75 0.64
76 0.63
77 0.68
78 0.68
79 0.66
80 0.62
81 0.59
82 0.52
83 0.42
84 0.37
85 0.32
86 0.3
87 0.28
88 0.26
89 0.23
90 0.23
91 0.26
92 0.27
93 0.25
94 0.27
95 0.31
96 0.32
97 0.31
98 0.3
99 0.28
100 0.27
101 0.25
102 0.19
103 0.14
104 0.12
105 0.15
106 0.2
107 0.25
108 0.29