Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399GCW0

Protein Details
Accession A0A399GCW0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-111HLAILPRRQMRRHRRDRRKRHIRTIRREGHSCFBasic
NLS Segment(s)
PositionSequence
85-105RRQMRRHRRDRRKRHIRTIRR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MQPPILISLGKDHQPAYRRRLDKEKKVKSLIQMQNVMPIPSIIYTTSQHLLISIPKDLLGTLHKHISRLPPFPLHLLLHLAILPRRQMRRHRRDRRKRHIRTIRREGHSCFRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.4
4 0.46
5 0.47
6 0.52
7 0.62
8 0.67
9 0.7
10 0.75
11 0.78
12 0.76
13 0.78
14 0.76
15 0.71
16 0.72
17 0.67
18 0.63
19 0.57
20 0.49
21 0.5
22 0.47
23 0.41
24 0.3
25 0.23
26 0.17
27 0.12
28 0.13
29 0.07
30 0.08
31 0.09
32 0.11
33 0.12
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.1
41 0.09
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.1
48 0.11
49 0.16
50 0.16
51 0.17
52 0.19
53 0.26
54 0.28
55 0.29
56 0.3
57 0.28
58 0.29
59 0.3
60 0.32
61 0.24
62 0.2
63 0.2
64 0.17
65 0.15
66 0.14
67 0.14
68 0.12
69 0.13
70 0.16
71 0.19
72 0.24
73 0.3
74 0.4
75 0.5
76 0.6
77 0.7
78 0.78
79 0.83
80 0.9
81 0.95
82 0.96
83 0.96
84 0.95
85 0.95
86 0.95
87 0.94
88 0.94
89 0.94
90 0.92
91 0.89
92 0.85
93 0.79
94 0.79