Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399GFC2

Protein Details
Accession A0A399GFC2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-68FVTSKMYPKKKDPNAKKGPLLGHydrophilic
NLS Segment(s)
PositionSequence
55-64KKKDPNAKKG
Subcellular Location(s) plas 8, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAFEWLAPILTPAALRSVQADGRPVITLFLVIFGLSVFGVLIWYVHFVTSKMYPKKKDPNAKKGPLLGFIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.13
5 0.14
6 0.15
7 0.17
8 0.14
9 0.15
10 0.16
11 0.14
12 0.12
13 0.1
14 0.09
15 0.07
16 0.07
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.02
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.08
36 0.13
37 0.22
38 0.3
39 0.36
40 0.41
41 0.49
42 0.6
43 0.67
44 0.73
45 0.75
46 0.78
47 0.82
48 0.85
49 0.81
50 0.78
51 0.71
52 0.68