Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A399HRW8

Protein Details
Accession A0A399HRW8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
107-128QDSIWARQERHRTKKPPRAITAHydrophilic
NLS Segment(s)
PositionSequence
74-93RRRKLDPFRRLRDLERKGQR
120-121KK
Subcellular Location(s) mito 8, nucl 5, cyto 4, plas 4, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPNVALPTVISKLGPPRLLDLLHVPKLEERMSPDANNPPKEKAPTLMFLGICLAITFVLAAPMVGIWLADRIRRRKLDPFRRLRDLERKGQRPGIDPPPYEKAPPQDSIWARQERHRTKKPPRAITADQVLGIDKTSYLQRIVPQSGSSAFNPNLECLLKNCNRRVRAATYSRACTYRMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.28
5 0.31
6 0.31
7 0.3
8 0.32
9 0.33
10 0.35
11 0.34
12 0.31
13 0.29
14 0.32
15 0.32
16 0.25
17 0.23
18 0.25
19 0.28
20 0.29
21 0.31
22 0.37
23 0.43
24 0.47
25 0.44
26 0.42
27 0.43
28 0.45
29 0.43
30 0.39
31 0.35
32 0.33
33 0.33
34 0.33
35 0.28
36 0.25
37 0.24
38 0.19
39 0.15
40 0.12
41 0.08
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.02
55 0.05
56 0.05
57 0.08
58 0.14
59 0.18
60 0.25
61 0.28
62 0.31
63 0.39
64 0.49
65 0.58
66 0.63
67 0.69
68 0.69
69 0.73
70 0.72
71 0.68
72 0.68
73 0.62
74 0.61
75 0.59
76 0.57
77 0.52
78 0.53
79 0.48
80 0.42
81 0.42
82 0.41
83 0.37
84 0.34
85 0.35
86 0.37
87 0.37
88 0.34
89 0.3
90 0.27
91 0.26
92 0.27
93 0.25
94 0.27
95 0.28
96 0.32
97 0.37
98 0.38
99 0.35
100 0.39
101 0.48
102 0.5
103 0.59
104 0.63
105 0.66
106 0.71
107 0.8
108 0.84
109 0.83
110 0.79
111 0.78
112 0.72
113 0.68
114 0.62
115 0.53
116 0.44
117 0.35
118 0.3
119 0.21
120 0.18
121 0.12
122 0.07
123 0.07
124 0.08
125 0.1
126 0.1
127 0.12
128 0.16
129 0.21
130 0.24
131 0.24
132 0.23
133 0.23
134 0.25
135 0.26
136 0.24
137 0.24
138 0.22
139 0.24
140 0.24
141 0.23
142 0.24
143 0.22
144 0.21
145 0.17
146 0.26
147 0.29
148 0.36
149 0.44
150 0.5
151 0.51
152 0.56
153 0.6
154 0.58
155 0.61
156 0.61
157 0.62
158 0.6
159 0.64
160 0.62
161 0.58