Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A399HV60

Protein Details
Accession A0A399HV60    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-121ICRKCYARLPPRAVNCRKKKCGHTNQLRPKKKLKHydrophilic
NLS Segment(s)
PositionSequence
115-121RPKKKLK
Subcellular Location(s) nucl 14.5, cyto_nucl 12, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLEDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKMICRKCYARLPPRAVNCRKKKCGHTNQLRPKKKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.24
5 0.26
6 0.26
7 0.23
8 0.27
9 0.29
10 0.3
11 0.35
12 0.31
13 0.39
14 0.44
15 0.46
16 0.43
17 0.43
18 0.42
19 0.4
20 0.38
21 0.29
22 0.26
23 0.26
24 0.25
25 0.22
26 0.22
27 0.18
28 0.21
29 0.21
30 0.19
31 0.17
32 0.16
33 0.16
34 0.13
35 0.13
36 0.1
37 0.16
38 0.18
39 0.19
40 0.2
41 0.19
42 0.18
43 0.18
44 0.2
45 0.15
46 0.14
47 0.12
48 0.13
49 0.14
50 0.15
51 0.15
52 0.13
53 0.1
54 0.09
55 0.1
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.14
66 0.14
67 0.2
68 0.23
69 0.28
70 0.3
71 0.31
72 0.35
73 0.39
74 0.48
75 0.46
76 0.47
77 0.46
78 0.5
79 0.58
80 0.64
81 0.63
82 0.63
83 0.66
84 0.69
85 0.75
86 0.79
87 0.8
88 0.8
89 0.81
90 0.82
91 0.84
92 0.84
93 0.85
94 0.86
95 0.87
96 0.88
97 0.88
98 0.89
99 0.91
100 0.94
101 0.94