Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A399GFT2

Protein Details
Accession A0A399GFT2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-71VFFGLRYMRKRELRPKRQRTMGVHydrophilic
NLS Segment(s)
PositionSequence
62-64RPK
Subcellular Location(s) mito 17, nucl 5, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MWILYRVHVHALQYISISWAILLTKHGRSLSGSLDLRERSDVGRQSSKVFFGLRYMRKRELRPKRQRTMGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.14
4 0.12
5 0.08
6 0.07
7 0.07
8 0.06
9 0.09
10 0.11
11 0.12
12 0.14
13 0.14
14 0.14
15 0.16
16 0.17
17 0.16
18 0.19
19 0.19
20 0.17
21 0.2
22 0.2
23 0.19
24 0.18
25 0.17
26 0.11
27 0.15
28 0.18
29 0.2
30 0.25
31 0.25
32 0.28
33 0.29
34 0.29
35 0.27
36 0.24
37 0.2
38 0.21
39 0.29
40 0.33
41 0.4
42 0.45
43 0.51
44 0.57
45 0.66
46 0.71
47 0.73
48 0.76
49 0.8
50 0.85
51 0.86