Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A399GCY1

Protein Details
Accession A0A399GCY1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-89LPSKHPRADNKPRNSKKPKTSBasic
NLS Segment(s)
PositionSequence
76-86ADNKPRNSKKP
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007740  Ribosomal_L49/IMG2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05046  Img2  
Amino Acid Sequences MPRFQSLVPLLRPLVAPRALACRQHFRFYTASSEHPSTPQEAQRAADLAAAESLTEGDSAQPPQQNPVLPSKHPRADNKPRNSKKPKTSSQTLKLSLPPPKYAVSRSVNKNLPIYTDYKRGGNLHLTTVRKITGDVSALRDELRVFLNKKNEDVKINSVTQHVVVKGHHTSEIAEFLKARGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.22
4 0.2
5 0.28
6 0.3
7 0.35
8 0.38
9 0.42
10 0.44
11 0.5
12 0.5
13 0.46
14 0.46
15 0.41
16 0.44
17 0.36
18 0.36
19 0.35
20 0.36
21 0.33
22 0.32
23 0.31
24 0.27
25 0.29
26 0.29
27 0.27
28 0.26
29 0.26
30 0.25
31 0.25
32 0.22
33 0.19
34 0.14
35 0.11
36 0.1
37 0.09
38 0.07
39 0.06
40 0.06
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.08
47 0.1
48 0.13
49 0.13
50 0.16
51 0.18
52 0.19
53 0.2
54 0.26
55 0.27
56 0.26
57 0.32
58 0.36
59 0.39
60 0.42
61 0.46
62 0.48
63 0.56
64 0.64
65 0.68
66 0.73
67 0.74
68 0.8
69 0.83
70 0.81
71 0.8
72 0.79
73 0.78
74 0.74
75 0.76
76 0.74
77 0.72
78 0.7
79 0.63
80 0.55
81 0.5
82 0.47
83 0.44
84 0.38
85 0.31
86 0.27
87 0.27
88 0.27
89 0.25
90 0.28
91 0.28
92 0.33
93 0.36
94 0.42
95 0.43
96 0.43
97 0.44
98 0.37
99 0.34
100 0.29
101 0.28
102 0.24
103 0.27
104 0.26
105 0.25
106 0.27
107 0.25
108 0.26
109 0.28
110 0.26
111 0.24
112 0.29
113 0.3
114 0.29
115 0.29
116 0.27
117 0.21
118 0.21
119 0.17
120 0.14
121 0.14
122 0.15
123 0.17
124 0.18
125 0.18
126 0.17
127 0.17
128 0.14
129 0.13
130 0.14
131 0.17
132 0.18
133 0.23
134 0.32
135 0.33
136 0.37
137 0.41
138 0.42
139 0.41
140 0.43
141 0.44
142 0.41
143 0.41
144 0.38
145 0.34
146 0.32
147 0.29
148 0.27
149 0.22
150 0.19
151 0.18
152 0.22
153 0.23
154 0.23
155 0.23
156 0.2
157 0.21
158 0.21
159 0.27
160 0.23
161 0.22
162 0.21