Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZT65

Protein Details
Accession A0A3A2ZT65    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-39GGSGCKDIRRHLRRNNKQITDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.833, cyto 6.5, cyto_pero 5.666, pero 3.5, mito 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF01636  APH  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MDLRSLPYPPGTSFGGVGGSGCKDIRRHLRRNNKQITDLSDFEDFLLDGSHSGGGVFAELIRQLSSPTHSPLSPSIVFTHGDLRPDNIVVDMGNGSEWIVTGLLDWEYSGFYPEYYEAVKCTNCLAPYEENDWFLYLPDCVSPKNYAHWWLLDRVRETWFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.14
4 0.13
5 0.11
6 0.1
7 0.11
8 0.11
9 0.13
10 0.13
11 0.21
12 0.32
13 0.39
14 0.48
15 0.57
16 0.68
17 0.76
18 0.86
19 0.88
20 0.82
21 0.78
22 0.72
23 0.69
24 0.64
25 0.54
26 0.46
27 0.36
28 0.32
29 0.26
30 0.23
31 0.15
32 0.09
33 0.09
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.09
53 0.1
54 0.12
55 0.14
56 0.13
57 0.15
58 0.15
59 0.2
60 0.18
61 0.17
62 0.16
63 0.16
64 0.16
65 0.15
66 0.19
67 0.14
68 0.15
69 0.14
70 0.15
71 0.14
72 0.14
73 0.13
74 0.08
75 0.08
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.09
102 0.09
103 0.1
104 0.09
105 0.12
106 0.12
107 0.12
108 0.14
109 0.16
110 0.15
111 0.17
112 0.2
113 0.2
114 0.24
115 0.28
116 0.27
117 0.25
118 0.25
119 0.24
120 0.21
121 0.18
122 0.15
123 0.1
124 0.1
125 0.11
126 0.12
127 0.12
128 0.15
129 0.18
130 0.19
131 0.24
132 0.27
133 0.29
134 0.31
135 0.34
136 0.35
137 0.38
138 0.42
139 0.42
140 0.41
141 0.39