Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2Z6L7

Protein Details
Accession A0A3A2Z6L7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAQVKQKKKWSKGKVKDKANHSVVHydrophilic
NLS Segment(s)
PositionSequence
7-16KKKWSKGKVK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAQVKQKKKWSKGKVKDKANHSVVLEKQTSERLQKDVQNFRLITVATLVDRLKINGSLARKALAELEENGQIKKVVGHHNMNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.89
4 0.85
5 0.84
6 0.75
7 0.68
8 0.58
9 0.55
10 0.47
11 0.44
12 0.38
13 0.29
14 0.26
15 0.27
16 0.28
17 0.26
18 0.26
19 0.24
20 0.27
21 0.31
22 0.37
23 0.41
24 0.41
25 0.42
26 0.41
27 0.37
28 0.35
29 0.31
30 0.23
31 0.16
32 0.13
33 0.07
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.1
42 0.12
43 0.14
44 0.15
45 0.16
46 0.16
47 0.16
48 0.15
49 0.16
50 0.14
51 0.13
52 0.12
53 0.14
54 0.17
55 0.18
56 0.18
57 0.17
58 0.16
59 0.14
60 0.16
61 0.19
62 0.23
63 0.29
64 0.34
65 0.37
66 0.44
67 0.47
68 0.46
69 0.43
70 0.36
71 0.3