Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NYR2

Protein Details
Accession B8NYR2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-101TPAPQPRSLSPRKRRRARDSSGPDTVHydrophilic
NLS Segment(s)
PositionSequence
84-93LSPRKRRRAR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEGLRFTGNTPPQAETQTTESTLTTLPTMPPTLSISGISQEAPSSATEGTRRSARLVQQIDRAQARNPYIFRGAPTPAPQPRSLSPRKRRRARDSSGPDTVAILRGRTRSDVTRNTASTSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.28
4 0.26
5 0.25
6 0.24
7 0.22
8 0.2
9 0.19
10 0.16
11 0.13
12 0.11
13 0.11
14 0.12
15 0.13
16 0.11
17 0.13
18 0.14
19 0.14
20 0.14
21 0.14
22 0.13
23 0.13
24 0.13
25 0.12
26 0.1
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.1
36 0.12
37 0.14
38 0.15
39 0.16
40 0.19
41 0.21
42 0.28
43 0.3
44 0.3
45 0.35
46 0.36
47 0.36
48 0.35
49 0.32
50 0.25
51 0.25
52 0.25
53 0.22
54 0.2
55 0.2
56 0.21
57 0.2
58 0.2
59 0.19
60 0.19
61 0.17
62 0.2
63 0.24
64 0.25
65 0.28
66 0.29
67 0.3
68 0.33
69 0.39
70 0.45
71 0.49
72 0.56
73 0.64
74 0.73
75 0.79
76 0.85
77 0.87
78 0.88
79 0.85
80 0.85
81 0.84
82 0.8
83 0.75
84 0.66
85 0.56
86 0.47
87 0.4
88 0.34
89 0.25
90 0.2
91 0.18
92 0.19
93 0.21
94 0.23
95 0.26
96 0.28
97 0.36
98 0.41
99 0.45
100 0.51
101 0.5
102 0.51
103 0.48