Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZCS4

Protein Details
Accession A0A3A2ZCS4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-72FSCFRCSSRKKTEKSRRNNTSDPRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9extr 9, mito 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTPGTLDFKSSTLIISLVLVPIVILICALALALACSEFWSSRPSPFSCFRCSSRKKTEKSRRNNTSDPRSSDSTEASGTFTPFDYGDPILPREHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.09
5 0.07
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.03
12 0.03
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.04
25 0.05
26 0.06
27 0.1
28 0.11
29 0.13
30 0.17
31 0.18
32 0.22
33 0.29
34 0.31
35 0.32
36 0.35
37 0.36
38 0.43
39 0.48
40 0.52
41 0.56
42 0.62
43 0.62
44 0.7
45 0.77
46 0.77
47 0.82
48 0.84
49 0.82
50 0.82
51 0.84
52 0.82
53 0.81
54 0.79
55 0.74
56 0.68
57 0.62
58 0.57
59 0.5
60 0.43
61 0.34
62 0.28
63 0.23
64 0.2
65 0.17
66 0.16
67 0.15
68 0.13
69 0.13
70 0.12
71 0.12
72 0.12
73 0.12
74 0.15
75 0.17
76 0.19