Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2ZJS9

Protein Details
Accession A0A3A2ZJS9    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-152EPGVKLCRKNERRCDKENHDCDBasic
NLS Segment(s)
Subcellular Location(s) extr 12, cyto 8, cyto_nucl 6.833, cyto_mito 4.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010621  DUF1214  
IPR037049  DUF1214_C_sf  
IPR010679  DUF1254  
IPR037050  DUF1254_sf  
Pfam View protein in Pfam  
PF06742  DUF1214  
PF06863  DUF1254  
Amino Acid Sequences MSAAISVQAEYSVDEATEFSLIYGYPLLAYAKFALPILSSKYGTNTLDHGRQLATASFQSVVRVNADTIYTKATLDLSESDLIIQVPEVTDRYWVFPFYDLYGNNYANLGSVKNSSPGKYRIRFASHGGQEPGVKLCRKNERRCDKENHDCDGLQGIINAPTPYGIFVGRFLVRDNSSDLEAVHAIQNQTALFTVSAERHHLIPKLTVALLNDSLSSDVPTKIMQMTARFNPFNPPRDISDRAHVDRMLRRAGIHNGHFTPTGSNLTAVAKKAFQGVLTYASNPPMVVNLKNNWYGISPSAQGDYGTDYKERYYIAYFGYLGLVASEAIYPSYRDPTNGGSATLSLTPKQAYLITFSSKPPLEKDGFWSITAYNAEQYLVPNPLNRYSIGDRSNLTYPDGSLVYSSSSKNESFQILVQPADVEPPKNWTSNWLPAPAGGGEMSITFRLYAASSSATNGEWAYPVVKKVDAFTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.08
10 0.08
11 0.07
12 0.07
13 0.08
14 0.1
15 0.09
16 0.11
17 0.12
18 0.13
19 0.13
20 0.14
21 0.13
22 0.13
23 0.16
24 0.2
25 0.22
26 0.22
27 0.22
28 0.25
29 0.29
30 0.29
31 0.28
32 0.27
33 0.28
34 0.32
35 0.32
36 0.3
37 0.26
38 0.26
39 0.26
40 0.22
41 0.19
42 0.15
43 0.16
44 0.16
45 0.15
46 0.17
47 0.17
48 0.17
49 0.16
50 0.17
51 0.15
52 0.15
53 0.17
54 0.16
55 0.15
56 0.16
57 0.15
58 0.14
59 0.14
60 0.13
61 0.12
62 0.13
63 0.13
64 0.14
65 0.14
66 0.14
67 0.13
68 0.13
69 0.13
70 0.11
71 0.09
72 0.06
73 0.06
74 0.07
75 0.08
76 0.07
77 0.11
78 0.12
79 0.15
80 0.16
81 0.16
82 0.16
83 0.17
84 0.18
85 0.18
86 0.21
87 0.18
88 0.22
89 0.26
90 0.25
91 0.23
92 0.22
93 0.19
94 0.16
95 0.16
96 0.12
97 0.09
98 0.11
99 0.11
100 0.16
101 0.18
102 0.19
103 0.24
104 0.31
105 0.39
106 0.4
107 0.44
108 0.45
109 0.5
110 0.5
111 0.5
112 0.52
113 0.47
114 0.48
115 0.45
116 0.4
117 0.34
118 0.33
119 0.31
120 0.26
121 0.24
122 0.22
123 0.27
124 0.37
125 0.46
126 0.55
127 0.62
128 0.69
129 0.74
130 0.79
131 0.82
132 0.8
133 0.81
134 0.77
135 0.7
136 0.62
137 0.55
138 0.48
139 0.41
140 0.32
141 0.21
142 0.16
143 0.11
144 0.1
145 0.11
146 0.1
147 0.08
148 0.08
149 0.07
150 0.08
151 0.08
152 0.07
153 0.06
154 0.07
155 0.1
156 0.11
157 0.11
158 0.12
159 0.14
160 0.15
161 0.16
162 0.17
163 0.15
164 0.15
165 0.15
166 0.14
167 0.12
168 0.11
169 0.11
170 0.1
171 0.1
172 0.1
173 0.09
174 0.11
175 0.09
176 0.09
177 0.08
178 0.08
179 0.06
180 0.06
181 0.07
182 0.08
183 0.09
184 0.11
185 0.12
186 0.12
187 0.15
188 0.16
189 0.16
190 0.15
191 0.15
192 0.15
193 0.14
194 0.14
195 0.12
196 0.12
197 0.12
198 0.11
199 0.1
200 0.08
201 0.09
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.09
211 0.1
212 0.11
213 0.15
214 0.17
215 0.21
216 0.21
217 0.21
218 0.28
219 0.31
220 0.33
221 0.32
222 0.31
223 0.31
224 0.36
225 0.4
226 0.33
227 0.35
228 0.36
229 0.34
230 0.34
231 0.31
232 0.29
233 0.28
234 0.29
235 0.24
236 0.2
237 0.19
238 0.2
239 0.24
240 0.25
241 0.23
242 0.25
243 0.23
244 0.24
245 0.24
246 0.21
247 0.18
248 0.15
249 0.15
250 0.11
251 0.11
252 0.1
253 0.12
254 0.13
255 0.13
256 0.13
257 0.11
258 0.11
259 0.13
260 0.12
261 0.1
262 0.1
263 0.1
264 0.13
265 0.13
266 0.14
267 0.13
268 0.14
269 0.14
270 0.12
271 0.11
272 0.1
273 0.12
274 0.12
275 0.14
276 0.16
277 0.19
278 0.21
279 0.21
280 0.19
281 0.18
282 0.17
283 0.15
284 0.15
285 0.13
286 0.12
287 0.12
288 0.12
289 0.11
290 0.1
291 0.13
292 0.12
293 0.12
294 0.13
295 0.12
296 0.13
297 0.14
298 0.14
299 0.11
300 0.12
301 0.12
302 0.12
303 0.13
304 0.13
305 0.12
306 0.12
307 0.1
308 0.08
309 0.07
310 0.06
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.05
317 0.06
318 0.07
319 0.12
320 0.11
321 0.12
322 0.14
323 0.17
324 0.22
325 0.22
326 0.21
327 0.17
328 0.17
329 0.18
330 0.19
331 0.17
332 0.12
333 0.13
334 0.13
335 0.13
336 0.14
337 0.14
338 0.11
339 0.15
340 0.17
341 0.19
342 0.21
343 0.21
344 0.26
345 0.26
346 0.27
347 0.25
348 0.28
349 0.27
350 0.27
351 0.32
352 0.35
353 0.35
354 0.34
355 0.32
356 0.26
357 0.27
358 0.27
359 0.22
360 0.14
361 0.13
362 0.13
363 0.12
364 0.14
365 0.13
366 0.14
367 0.14
368 0.17
369 0.19
370 0.22
371 0.23
372 0.23
373 0.26
374 0.28
375 0.34
376 0.33
377 0.33
378 0.31
379 0.33
380 0.37
381 0.32
382 0.29
383 0.23
384 0.21
385 0.21
386 0.2
387 0.17
388 0.13
389 0.12
390 0.13
391 0.15
392 0.15
393 0.14
394 0.17
395 0.18
396 0.19
397 0.22
398 0.21
399 0.2
400 0.22
401 0.26
402 0.24
403 0.24
404 0.22
405 0.21
406 0.18
407 0.23
408 0.22
409 0.18
410 0.16
411 0.23
412 0.26
413 0.26
414 0.26
415 0.27
416 0.32
417 0.39
418 0.42
419 0.39
420 0.37
421 0.35
422 0.38
423 0.31
424 0.26
425 0.16
426 0.13
427 0.1
428 0.1
429 0.11
430 0.09
431 0.09
432 0.08
433 0.08
434 0.09
435 0.09
436 0.09
437 0.1
438 0.12
439 0.12
440 0.14
441 0.15
442 0.14
443 0.15
444 0.14
445 0.13
446 0.12
447 0.12
448 0.14
449 0.15
450 0.17
451 0.18
452 0.2
453 0.2