Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A3A845

Protein Details
Accession A0A3A3A845    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-30GVQFLTARPRKRPHHRMSGSHYRSRHydrophilic
36-59EGEPSSSRRRPRSPQPPPSSPPARHydrophilic
87-106EPDSSPQRPQRRRRSGDSASHydrophilic
NLS Segment(s)
PositionSequence
14-21PRKRPHHR
43-47RRRPR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038886  E3_SLX5/Rfp1  
Amino Acid Sequences MSDDSGVQFLTARPRKRPHHRMSGSHYRSRSPWSQEGEPSSSRRRPRSPQPPPSSPPARYPGDGLDFRRPAMSSTNQQEPVIDLTNEPDSSPQRPQRRRRSGDSASPNARPPRFGRDILQEPDVVDLVDEPESPEIIDPPGSPEVQFVGATSRPRRFDLRSGVIDMMRRAARFGGDYYRGDHIWSDRYLRNLPPPLDVETLLIGEGAGRGIDVELNFGTVSPVAQPEPGPPRDSYKPPSPAPEGFTRSIGEDEVVVCPNCDVELGTGDGVKQQIFVAKKCGHVRIAFSII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.7
4 0.79
5 0.78
6 0.82
7 0.85
8 0.85
9 0.85
10 0.86
11 0.82
12 0.79
13 0.72
14 0.64
15 0.58
16 0.57
17 0.55
18 0.51
19 0.52
20 0.51
21 0.53
22 0.55
23 0.58
24 0.56
25 0.52
26 0.49
27 0.5
28 0.51
29 0.54
30 0.57
31 0.59
32 0.63
33 0.7
34 0.76
35 0.78
36 0.82
37 0.84
38 0.84
39 0.8
40 0.81
41 0.77
42 0.68
43 0.64
44 0.59
45 0.53
46 0.46
47 0.44
48 0.39
49 0.38
50 0.39
51 0.36
52 0.38
53 0.36
54 0.35
55 0.35
56 0.31
57 0.26
58 0.27
59 0.28
60 0.27
61 0.31
62 0.37
63 0.37
64 0.37
65 0.36
66 0.32
67 0.3
68 0.25
69 0.21
70 0.14
71 0.14
72 0.16
73 0.16
74 0.15
75 0.15
76 0.15
77 0.18
78 0.26
79 0.31
80 0.4
81 0.49
82 0.59
83 0.68
84 0.76
85 0.79
86 0.79
87 0.81
88 0.76
89 0.76
90 0.74
91 0.7
92 0.63
93 0.59
94 0.56
95 0.53
96 0.47
97 0.41
98 0.35
99 0.36
100 0.37
101 0.36
102 0.34
103 0.35
104 0.41
105 0.4
106 0.39
107 0.31
108 0.26
109 0.25
110 0.22
111 0.14
112 0.08
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.08
127 0.09
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.09
134 0.07
135 0.08
136 0.1
137 0.13
138 0.17
139 0.2
140 0.21
141 0.23
142 0.27
143 0.28
144 0.32
145 0.36
146 0.38
147 0.36
148 0.36
149 0.35
150 0.33
151 0.31
152 0.25
153 0.21
154 0.16
155 0.14
156 0.13
157 0.12
158 0.11
159 0.11
160 0.13
161 0.13
162 0.16
163 0.16
164 0.18
165 0.2
166 0.19
167 0.19
168 0.18
169 0.15
170 0.16
171 0.16
172 0.19
173 0.18
174 0.22
175 0.24
176 0.26
177 0.31
178 0.33
179 0.33
180 0.31
181 0.32
182 0.32
183 0.31
184 0.29
185 0.22
186 0.17
187 0.16
188 0.13
189 0.11
190 0.06
191 0.05
192 0.05
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.05
199 0.05
200 0.06
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.06
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.09
213 0.14
214 0.21
215 0.23
216 0.25
217 0.25
218 0.31
219 0.36
220 0.42
221 0.43
222 0.45
223 0.5
224 0.5
225 0.55
226 0.54
227 0.51
228 0.49
229 0.51
230 0.47
231 0.42
232 0.41
233 0.36
234 0.32
235 0.3
236 0.26
237 0.18
238 0.13
239 0.12
240 0.13
241 0.15
242 0.13
243 0.12
244 0.11
245 0.11
246 0.11
247 0.1
248 0.08
249 0.07
250 0.09
251 0.1
252 0.11
253 0.11
254 0.11
255 0.13
256 0.13
257 0.12
258 0.1
259 0.1
260 0.15
261 0.19
262 0.2
263 0.27
264 0.29
265 0.37
266 0.42
267 0.46
268 0.46
269 0.45
270 0.48