Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZVQ1

Protein Details
Accession A0A3A2ZVQ1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-67SHSQVVRRFRRYDRRTPPKAKYDLLHydrophilic
179-205RTNSWGKEVSKRRRRNIRQRWYNSALRHydrophilic
NLS Segment(s)
PositionSequence
189-193KRRRR
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046896  Cup1-like_N  
Pfam View protein in Pfam  
PF20263  LYRM2-like  
CDD cd20273  Complex1_LYR_unchar  
Amino Acid Sequences MPGPVSGKVWLPNPYTPRDWLNLYRSLLRECSYLPDPIARDYSHSQVVRRFRRYDRRTPPKAKYDLLWQSAHRKTALRGLSLLKRANAGYSKPLEKVLRLAYGRIGPRRRELVATTIAPEVPADNLVVAELLKKPTMFEDGWEPPEIMVNLMKSQDSNTAISRLGVLQKVKTFEPPIPRTNSWGKEVSKRRRRNIRQRWYNSALRSLFPPLPEPDLKILDGLISGSVPWKPVKRRTPVGTWPTPLESLSDFLEGGPKKGHTFRVWASGRPHNITYRFMRRLWQRISCLVPRLEWSEETQKHRFHWGTMKKEGDVSYKVESGQSPSLFKNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.45
4 0.45
5 0.42
6 0.44
7 0.44
8 0.44
9 0.46
10 0.45
11 0.47
12 0.46
13 0.45
14 0.42
15 0.36
16 0.33
17 0.26
18 0.3
19 0.27
20 0.26
21 0.24
22 0.26
23 0.26
24 0.28
25 0.31
26 0.24
27 0.27
28 0.29
29 0.31
30 0.34
31 0.35
32 0.35
33 0.38
34 0.48
35 0.52
36 0.56
37 0.58
38 0.6
39 0.69
40 0.74
41 0.78
42 0.79
43 0.8
44 0.84
45 0.87
46 0.86
47 0.85
48 0.83
49 0.74
50 0.65
51 0.64
52 0.62
53 0.57
54 0.52
55 0.45
56 0.48
57 0.49
58 0.49
59 0.41
60 0.34
61 0.31
62 0.36
63 0.37
64 0.29
65 0.28
66 0.31
67 0.35
68 0.39
69 0.4
70 0.32
71 0.31
72 0.29
73 0.31
74 0.28
75 0.24
76 0.24
77 0.26
78 0.28
79 0.27
80 0.32
81 0.29
82 0.27
83 0.3
84 0.26
85 0.28
86 0.27
87 0.26
88 0.24
89 0.28
90 0.32
91 0.35
92 0.38
93 0.34
94 0.38
95 0.41
96 0.4
97 0.37
98 0.34
99 0.31
100 0.3
101 0.28
102 0.25
103 0.22
104 0.21
105 0.18
106 0.16
107 0.12
108 0.07
109 0.07
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.13
124 0.12
125 0.11
126 0.17
127 0.19
128 0.21
129 0.21
130 0.2
131 0.16
132 0.18
133 0.17
134 0.11
135 0.09
136 0.08
137 0.08
138 0.09
139 0.09
140 0.07
141 0.08
142 0.11
143 0.12
144 0.13
145 0.13
146 0.14
147 0.14
148 0.14
149 0.13
150 0.11
151 0.11
152 0.11
153 0.11
154 0.11
155 0.13
156 0.15
157 0.15
158 0.17
159 0.17
160 0.18
161 0.26
162 0.29
163 0.32
164 0.36
165 0.36
166 0.39
167 0.44
168 0.43
169 0.37
170 0.38
171 0.36
172 0.39
173 0.49
174 0.55
175 0.59
176 0.65
177 0.7
178 0.76
179 0.84
180 0.86
181 0.88
182 0.88
183 0.89
184 0.87
185 0.86
186 0.82
187 0.77
188 0.67
189 0.63
190 0.53
191 0.42
192 0.38
193 0.33
194 0.28
195 0.23
196 0.24
197 0.19
198 0.22
199 0.22
200 0.23
201 0.21
202 0.22
203 0.21
204 0.18
205 0.16
206 0.12
207 0.11
208 0.09
209 0.06
210 0.04
211 0.04
212 0.05
213 0.05
214 0.07
215 0.1
216 0.16
217 0.22
218 0.32
219 0.4
220 0.47
221 0.55
222 0.59
223 0.64
224 0.68
225 0.7
226 0.65
227 0.6
228 0.54
229 0.48
230 0.43
231 0.35
232 0.28
233 0.2
234 0.17
235 0.15
236 0.14
237 0.11
238 0.1
239 0.17
240 0.15
241 0.16
242 0.17
243 0.16
244 0.19
245 0.23
246 0.28
247 0.24
248 0.3
249 0.3
250 0.39
251 0.4
252 0.42
253 0.44
254 0.47
255 0.49
256 0.47
257 0.48
258 0.45
259 0.46
260 0.46
261 0.48
262 0.5
263 0.49
264 0.46
265 0.51
266 0.52
267 0.59
268 0.6
269 0.6
270 0.55
271 0.56
272 0.62
273 0.59
274 0.57
275 0.49
276 0.43
277 0.39
278 0.39
279 0.36
280 0.31
281 0.32
282 0.36
283 0.41
284 0.46
285 0.49
286 0.48
287 0.48
288 0.56
289 0.51
290 0.46
291 0.51
292 0.53
293 0.55
294 0.6
295 0.61
296 0.53
297 0.56
298 0.53
299 0.49
300 0.42
301 0.38
302 0.34
303 0.32
304 0.31
305 0.29
306 0.28
307 0.28
308 0.31
309 0.3
310 0.29
311 0.3