Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZEN4

Protein Details
Accession A0A3A2ZEN4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-31FPSQDRRSKSSKGYRKPLLSPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, mito 7, E.R. 5, extr 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008217  Ccc1_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0005384  F:manganese ion transmembrane transporter activity  
GO:0030026  P:intracellular manganese ion homeostasis  
Pfam View protein in Pfam  
PF01988  VIT1  
CDD cd02435  CCC1  
Amino Acid Sequences MALLFLKQKLFPSQDRRSKSSKGYRKPLLSPVDDGDTIRGDYYPEDIESQRFRYDTFDDSTTEEDAASTGSSRSRINPRIVSDSILGLSDGLTVPFALSAGLSALGNTKVVVLGGLAELAAGAISMGLGGYVGAKSEAESYETTVRETEQLIETSPSETSAIVHDTFASLGLSEDAISQINNSLHRSHDRLLDFLITFHHKESAPDCNQAWISAITLALGYFVGGFIPLIPYFIVDRVIVALNYSIGVMAITLLAFGYIKTCIVRGWTGRDNIMAGIKGGIQMCFVGGVAAGAAIGLVRLINGGEGGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.7
4 0.69
5 0.7
6 0.72
7 0.73
8 0.72
9 0.74
10 0.77
11 0.8
12 0.8
13 0.79
14 0.77
15 0.74
16 0.66
17 0.59
18 0.52
19 0.48
20 0.42
21 0.37
22 0.3
23 0.24
24 0.21
25 0.18
26 0.15
27 0.11
28 0.11
29 0.13
30 0.12
31 0.12
32 0.14
33 0.15
34 0.2
35 0.23
36 0.25
37 0.25
38 0.24
39 0.23
40 0.25
41 0.26
42 0.26
43 0.26
44 0.25
45 0.23
46 0.25
47 0.26
48 0.23
49 0.2
50 0.16
51 0.12
52 0.1
53 0.09
54 0.08
55 0.06
56 0.06
57 0.08
58 0.1
59 0.11
60 0.16
61 0.25
62 0.31
63 0.37
64 0.41
65 0.43
66 0.48
67 0.48
68 0.44
69 0.36
70 0.31
71 0.25
72 0.2
73 0.16
74 0.09
75 0.09
76 0.07
77 0.06
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.04
91 0.05
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.01
111 0.01
112 0.01
113 0.01
114 0.01
115 0.01
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.05
124 0.05
125 0.07
126 0.07
127 0.09
128 0.13
129 0.13
130 0.13
131 0.12
132 0.13
133 0.11
134 0.12
135 0.11
136 0.09
137 0.09
138 0.09
139 0.1
140 0.1
141 0.09
142 0.09
143 0.08
144 0.07
145 0.06
146 0.06
147 0.06
148 0.08
149 0.08
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.07
167 0.08
168 0.1
169 0.11
170 0.12
171 0.14
172 0.17
173 0.2
174 0.19
175 0.24
176 0.24
177 0.23
178 0.23
179 0.23
180 0.2
181 0.17
182 0.18
183 0.14
184 0.14
185 0.14
186 0.16
187 0.14
188 0.15
189 0.18
190 0.24
191 0.24
192 0.27
193 0.26
194 0.26
195 0.26
196 0.25
197 0.24
198 0.16
199 0.14
200 0.1
201 0.1
202 0.07
203 0.07
204 0.07
205 0.05
206 0.05
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.05
215 0.05
216 0.06
217 0.06
218 0.07
219 0.08
220 0.09
221 0.1
222 0.08
223 0.08
224 0.09
225 0.1
226 0.09
227 0.09
228 0.08
229 0.07
230 0.07
231 0.07
232 0.05
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.05
245 0.05
246 0.06
247 0.07
248 0.07
249 0.08
250 0.11
251 0.16
252 0.18
253 0.25
254 0.3
255 0.32
256 0.33
257 0.33
258 0.31
259 0.28
260 0.28
261 0.21
262 0.15
263 0.13
264 0.12
265 0.14
266 0.14
267 0.13
268 0.1
269 0.1
270 0.1
271 0.09
272 0.09
273 0.06
274 0.05
275 0.05
276 0.04
277 0.04
278 0.03
279 0.03
280 0.03
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.03
287 0.03
288 0.04
289 0.04