Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z8V6

Protein Details
Accession A0A3A2Z8V6    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-51GSCRCRRTGRTTFVKRHLTGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9cyto_nucl 9, nucl 7, mito 7, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR002041  Ran_GTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
Gene Ontology GO:0005634  C:nucleus  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0006913  P:nucleocytoplasmic transport  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51418  RAN  
PS51421  RAS  
CDD cd00877  Ran  
Amino Acid Sequences MAEAQQAPPTFKLVLVGDGGTGKASIISCLFGSCRCRRTGRTTFVKRHLTGEFEKKYIATLGVEVHPLTFTTNFGTIQFDVWDTAGQEKFGGLRDGYYINGQCGVIMFDVTSRITYKNVPNWHRDLVRVCEGIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPGLEFVAAPALAPPEVQVNPELMDQYKQEMEAAAQMPLPDEEDPDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.14
5 0.14
6 0.14
7 0.1
8 0.09
9 0.07
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.1
16 0.11
17 0.12
18 0.14
19 0.21
20 0.26
21 0.3
22 0.33
23 0.39
24 0.43
25 0.52
26 0.58
27 0.6
28 0.65
29 0.71
30 0.75
31 0.78
32 0.81
33 0.72
34 0.67
35 0.59
36 0.53
37 0.5
38 0.51
39 0.45
40 0.37
41 0.36
42 0.32
43 0.31
44 0.26
45 0.21
46 0.12
47 0.1
48 0.11
49 0.12
50 0.13
51 0.12
52 0.11
53 0.1
54 0.09
55 0.1
56 0.08
57 0.08
58 0.09
59 0.1
60 0.1
61 0.11
62 0.13
63 0.12
64 0.12
65 0.12
66 0.1
67 0.1
68 0.09
69 0.09
70 0.07
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.1
78 0.11
79 0.07
80 0.07
81 0.09
82 0.09
83 0.1
84 0.11
85 0.11
86 0.09
87 0.1
88 0.1
89 0.08
90 0.08
91 0.08
92 0.06
93 0.05
94 0.05
95 0.04
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.08
102 0.11
103 0.15
104 0.2
105 0.27
106 0.3
107 0.33
108 0.36
109 0.39
110 0.36
111 0.35
112 0.33
113 0.29
114 0.3
115 0.26
116 0.23
117 0.21
118 0.2
119 0.17
120 0.14
121 0.1
122 0.07
123 0.08
124 0.08
125 0.06
126 0.08
127 0.1
128 0.1
129 0.16
130 0.21
131 0.24
132 0.33
133 0.36
134 0.44
135 0.44
136 0.49
137 0.5
138 0.53
139 0.55
140 0.56
141 0.65
142 0.63
143 0.68
144 0.69
145 0.69
146 0.67
147 0.7
148 0.66
149 0.59
150 0.54
151 0.52
152 0.54
153 0.49
154 0.46
155 0.37
156 0.32
157 0.29
158 0.33
159 0.28
160 0.25
161 0.24
162 0.24
163 0.25
164 0.25
165 0.3
166 0.28
167 0.3
168 0.28
169 0.29
170 0.32
171 0.32
172 0.3
173 0.31
174 0.32
175 0.3
176 0.28
177 0.27
178 0.22
179 0.2
180 0.19
181 0.13
182 0.1
183 0.08
184 0.07
185 0.06
186 0.07
187 0.07
188 0.07
189 0.07
190 0.1
191 0.11
192 0.12
193 0.12
194 0.12
195 0.14
196 0.15
197 0.16
198 0.13
199 0.15
200 0.14
201 0.18
202 0.17
203 0.16
204 0.16
205 0.15
206 0.14
207 0.18
208 0.18
209 0.15
210 0.15
211 0.14
212 0.15
213 0.15
214 0.17
215 0.11