Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2ZX70

Protein Details
Accession A0A3A2ZX70    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
186-209VPPALNPPPKGKRRKTAGGNEHNIHydrophilic
NLS Segment(s)
PositionSequence
193-200PPKGKRRK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPSKPSLPPLKTPKTMPFPSELYDSPIKESPNSPKREGDDTASITPPAAYTEFLQALTPIFGNPKSAGEDFHKNIAERRGRSPVSRSSHTANVPFSSGKETKSSAALPSPSQTPQSAKPPGPLRRLRIPTLLYSPATCSPQSAYSVRSPYSPPEWRRRYLESPRSADEDTFSVRHVMTRTITYRVPPALNPPPKGKRRKTAGGNEHNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.65
4 0.58
5 0.53
6 0.47
7 0.46
8 0.45
9 0.37
10 0.34
11 0.35
12 0.33
13 0.32
14 0.33
15 0.31
16 0.28
17 0.32
18 0.37
19 0.41
20 0.46
21 0.45
22 0.47
23 0.5
24 0.54
25 0.51
26 0.45
27 0.43
28 0.41
29 0.4
30 0.36
31 0.32
32 0.26
33 0.24
34 0.19
35 0.14
36 0.11
37 0.09
38 0.09
39 0.13
40 0.14
41 0.14
42 0.14
43 0.12
44 0.12
45 0.11
46 0.1
47 0.07
48 0.08
49 0.08
50 0.1
51 0.11
52 0.11
53 0.14
54 0.15
55 0.17
56 0.19
57 0.26
58 0.25
59 0.29
60 0.29
61 0.26
62 0.29
63 0.35
64 0.36
65 0.32
66 0.35
67 0.37
68 0.37
69 0.39
70 0.4
71 0.41
72 0.41
73 0.41
74 0.4
75 0.37
76 0.4
77 0.4
78 0.38
79 0.3
80 0.25
81 0.23
82 0.21
83 0.17
84 0.18
85 0.17
86 0.16
87 0.16
88 0.17
89 0.16
90 0.18
91 0.18
92 0.13
93 0.14
94 0.14
95 0.13
96 0.13
97 0.14
98 0.13
99 0.14
100 0.14
101 0.15
102 0.17
103 0.24
104 0.27
105 0.26
106 0.31
107 0.38
108 0.44
109 0.5
110 0.51
111 0.5
112 0.54
113 0.58
114 0.55
115 0.51
116 0.46
117 0.4
118 0.4
119 0.37
120 0.28
121 0.24
122 0.25
123 0.22
124 0.23
125 0.2
126 0.16
127 0.15
128 0.17
129 0.2
130 0.18
131 0.19
132 0.21
133 0.25
134 0.24
135 0.24
136 0.24
137 0.24
138 0.31
139 0.36
140 0.38
141 0.46
142 0.51
143 0.54
144 0.58
145 0.62
146 0.63
147 0.65
148 0.68
149 0.66
150 0.66
151 0.64
152 0.63
153 0.56
154 0.48
155 0.39
156 0.31
157 0.26
158 0.22
159 0.2
160 0.17
161 0.16
162 0.18
163 0.17
164 0.18
165 0.17
166 0.22
167 0.24
168 0.27
169 0.28
170 0.28
171 0.31
172 0.32
173 0.32
174 0.27
175 0.33
176 0.4
177 0.46
178 0.48
179 0.53
180 0.59
181 0.66
182 0.76
183 0.76
184 0.76
185 0.77
186 0.83
187 0.83
188 0.85
189 0.86