Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZF75

Protein Details
Accession A0A3A2ZF75   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-49SGKLRPFIKKSKPEKKEKIEEEBasic
NLS Segment(s)
PositionSequence
32-45RPFIKKSKPEKKEK
Subcellular Location(s) nucl 13, cyto_nucl 12.833, cyto 9.5, mito_nucl 9.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR015433  PI_Kinase  
Gene Ontology GO:0046854  P:phosphatidylinositol phosphate biosynthetic process  
GO:0048015  P:phosphatidylinositol-mediated signaling  
Amino Acid Sequences SLISSFSDEEREFYEREFSFFNDVTGVSGKLRPFIKKSKPEKKEKIEEELRKIQVEVGVYLPSNPDGSVVGIDRKSGKPLQSHAKAPYMAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.23
4 0.23
5 0.21
6 0.24
7 0.23
8 0.22
9 0.16
10 0.16
11 0.15
12 0.15
13 0.14
14 0.1
15 0.13
16 0.13
17 0.17
18 0.19
19 0.21
20 0.24
21 0.32
22 0.4
23 0.48
24 0.58
25 0.64
26 0.7
27 0.78
28 0.82
29 0.82
30 0.82
31 0.74
32 0.72
33 0.71
34 0.67
35 0.63
36 0.6
37 0.53
38 0.44
39 0.41
40 0.34
41 0.26
42 0.22
43 0.17
44 0.11
45 0.1
46 0.1
47 0.1
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.07
55 0.08
56 0.09
57 0.12
58 0.12
59 0.14
60 0.17
61 0.18
62 0.22
63 0.25
64 0.28
65 0.29
66 0.36
67 0.45
68 0.47
69 0.52
70 0.52
71 0.54