Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NVW4

Protein Details
Accession B8NVW4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-87LLTSNPRRPHSHKRANRKGGNHWVVHydrophilic
NLS Segment(s)
PositionSequence
70-80RPHSHKRANRK
Subcellular Location(s) mito 10, cyto 8.5, cyto_nucl 7.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MAPQQPEFPITRYLIAGLRTFFYSQLFVTPSYPELVCRPNRHRHWVEYRSRPRSRAPFLSSQLLTSNPRRPHSHKRANRKGGNHWVVTEGYEQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.18
5 0.18
6 0.18
7 0.18
8 0.17
9 0.15
10 0.14
11 0.12
12 0.14
13 0.14
14 0.13
15 0.13
16 0.13
17 0.13
18 0.14
19 0.13
20 0.12
21 0.13
22 0.19
23 0.23
24 0.3
25 0.35
26 0.43
27 0.48
28 0.55
29 0.56
30 0.57
31 0.62
32 0.63
33 0.65
34 0.66
35 0.71
36 0.71
37 0.71
38 0.66
39 0.63
40 0.62
41 0.6
42 0.56
43 0.52
44 0.5
45 0.5
46 0.53
47 0.47
48 0.4
49 0.35
50 0.3
51 0.29
52 0.27
53 0.32
54 0.32
55 0.36
56 0.42
57 0.48
58 0.57
59 0.64
60 0.7
61 0.71
62 0.77
63 0.84
64 0.88
65 0.88
66 0.83
67 0.82
68 0.82
69 0.79
70 0.7
71 0.59
72 0.52
73 0.45
74 0.4
75 0.32