Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2Z2I6

Protein Details
Accession A0A3A2Z2I6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-73NLPNERPKMSRRPPQRRQGLRHydrophilic
NLS Segment(s)
PositionSequence
23-73PRTRTKAARKIRAAMNLTSPREVTKKKRLLNLPNERPKMSRRPPQRRQGLR
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences RQRRPRQMVSNLALLLRAAMKTPRTRTKAARKIRAAMNLTSPREVTKKKRLLNLPNERPKMSRRPPQRRQGLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.24
3 0.16
4 0.12
5 0.08
6 0.1
7 0.15
8 0.21
9 0.28
10 0.36
11 0.4
12 0.45
13 0.53
14 0.61
15 0.66
16 0.7
17 0.72
18 0.66
19 0.67
20 0.66
21 0.64
22 0.55
23 0.46
24 0.45
25 0.41
26 0.39
27 0.34
28 0.31
29 0.25
30 0.28
31 0.32
32 0.32
33 0.37
34 0.44
35 0.48
36 0.56
37 0.63
38 0.68
39 0.73
40 0.77
41 0.77
42 0.79
43 0.78
44 0.72
45 0.67
46 0.63
47 0.63
48 0.61
49 0.61
50 0.62
51 0.69
52 0.77
53 0.85