Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZY58

Protein Details
Accession A0A3A2ZY58    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-110DLLARFRPDKWRKKFLSNRGNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016149  Casein_kin_II_reg-sub_N  
IPR035991  Casein_kinase_II_beta-like  
IPR000704  Casein_kinase_II_reg-sub  
Gene Ontology GO:0005956  C:protein kinase CK2 complex  
GO:0016301  F:kinase activity  
GO:0019887  F:protein kinase regulator activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01214  CK_II_beta  
PROSITE View protein in PROSITE  
PS01101  CK2_BETA  
Amino Acid Sequences MDPSPASPETQAVGPRDAPSPHPSDEAVSEVIAALAPVTLGPVAVEAPMPPERDDAFSLDTQIPLRSMSEDNSPPGGVSIFSAFNFLPDLLARFRPDKWRKKFLSNRGNEYFCEIDEEYLTDRFNLTGLNAEVPYYQYALDLITDVFDIDADDQLREQIDKSASHLYGLVHARYIVTTRGLAKMAEKYKKGDFGKCPRLMCEGQPLLPAGQSDIPNTSTVKLHCPKCEDLYNPKSSRHAAIDGAYFGTTFHSMLFQVHPNLVPEKSIRRYEPKIYGFRVHALAALARWQDQYREEMKSRLKEAGVDFKYAEETDDEEREDMSDSEEEGKAGNKDEAKGEKVLGDAASGQMDLGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.3
4 0.3
5 0.3
6 0.31
7 0.34
8 0.32
9 0.33
10 0.31
11 0.3
12 0.29
13 0.28
14 0.23
15 0.18
16 0.15
17 0.13
18 0.12
19 0.1
20 0.08
21 0.05
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.06
33 0.05
34 0.09
35 0.13
36 0.15
37 0.15
38 0.18
39 0.19
40 0.22
41 0.23
42 0.22
43 0.22
44 0.21
45 0.24
46 0.22
47 0.22
48 0.2
49 0.19
50 0.16
51 0.13
52 0.14
53 0.13
54 0.14
55 0.14
56 0.2
57 0.21
58 0.23
59 0.24
60 0.23
61 0.2
62 0.19
63 0.18
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.12
70 0.11
71 0.11
72 0.12
73 0.11
74 0.09
75 0.08
76 0.11
77 0.11
78 0.14
79 0.16
80 0.17
81 0.2
82 0.3
83 0.4
84 0.48
85 0.54
86 0.62
87 0.65
88 0.74
89 0.8
90 0.8
91 0.81
92 0.77
93 0.77
94 0.73
95 0.7
96 0.59
97 0.54
98 0.44
99 0.33
100 0.31
101 0.22
102 0.17
103 0.15
104 0.16
105 0.13
106 0.13
107 0.13
108 0.09
109 0.09
110 0.08
111 0.08
112 0.07
113 0.06
114 0.08
115 0.08
116 0.1
117 0.09
118 0.1
119 0.1
120 0.11
121 0.11
122 0.08
123 0.08
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.08
146 0.1
147 0.1
148 0.13
149 0.16
150 0.16
151 0.16
152 0.17
153 0.14
154 0.17
155 0.19
156 0.16
157 0.12
158 0.12
159 0.12
160 0.11
161 0.12
162 0.07
163 0.06
164 0.07
165 0.08
166 0.09
167 0.1
168 0.1
169 0.11
170 0.16
171 0.22
172 0.25
173 0.25
174 0.27
175 0.28
176 0.36
177 0.37
178 0.37
179 0.39
180 0.44
181 0.53
182 0.54
183 0.53
184 0.47
185 0.5
186 0.45
187 0.38
188 0.36
189 0.28
190 0.24
191 0.24
192 0.23
193 0.18
194 0.18
195 0.16
196 0.09
197 0.11
198 0.11
199 0.11
200 0.12
201 0.12
202 0.13
203 0.14
204 0.14
205 0.13
206 0.13
207 0.21
208 0.27
209 0.29
210 0.31
211 0.36
212 0.37
213 0.39
214 0.43
215 0.39
216 0.42
217 0.45
218 0.51
219 0.48
220 0.47
221 0.46
222 0.43
223 0.42
224 0.35
225 0.3
226 0.22
227 0.22
228 0.22
229 0.2
230 0.18
231 0.15
232 0.12
233 0.09
234 0.1
235 0.08
236 0.07
237 0.07
238 0.07
239 0.07
240 0.09
241 0.11
242 0.13
243 0.14
244 0.15
245 0.15
246 0.16
247 0.19
248 0.17
249 0.16
250 0.17
251 0.23
252 0.27
253 0.31
254 0.34
255 0.39
256 0.44
257 0.5
258 0.56
259 0.56
260 0.58
261 0.57
262 0.57
263 0.52
264 0.49
265 0.44
266 0.35
267 0.29
268 0.23
269 0.19
270 0.15
271 0.17
272 0.14
273 0.14
274 0.15
275 0.15
276 0.16
277 0.17
278 0.23
279 0.23
280 0.29
281 0.3
282 0.35
283 0.42
284 0.45
285 0.46
286 0.45
287 0.41
288 0.39
289 0.41
290 0.45
291 0.39
292 0.36
293 0.33
294 0.29
295 0.31
296 0.27
297 0.23
298 0.14
299 0.15
300 0.17
301 0.19
302 0.19
303 0.17
304 0.17
305 0.17
306 0.17
307 0.15
308 0.14
309 0.13
310 0.13
311 0.16
312 0.16
313 0.16
314 0.14
315 0.17
316 0.16
317 0.17
318 0.21
319 0.2
320 0.21
321 0.28
322 0.32
323 0.32
324 0.33
325 0.31
326 0.28
327 0.26
328 0.26
329 0.2
330 0.16
331 0.13
332 0.13
333 0.12
334 0.11