Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z2J5

Protein Details
Accession A0A3A2Z2J5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-72AKVGLLWRKDPKKKRARSPWQEWGALHydrophilic
NLS Segment(s)
PositionSequence
54-63RKDPKKKRAR
Subcellular Location(s) nucl 15, mito 4, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MDSLHETLAESGILQIVSARSRPDAFMQASIGTPADSHPGLVDIKVAKVGLLWRKDPKKKRARSPWQEWGALLTFSQLYFFRDVNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.09
5 0.1
6 0.11
7 0.12
8 0.13
9 0.15
10 0.16
11 0.2
12 0.2
13 0.2
14 0.2
15 0.19
16 0.18
17 0.17
18 0.14
19 0.09
20 0.07
21 0.06
22 0.08
23 0.07
24 0.07
25 0.06
26 0.08
27 0.08
28 0.08
29 0.09
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.1
37 0.14
38 0.17
39 0.2
40 0.28
41 0.37
42 0.46
43 0.55
44 0.62
45 0.67
46 0.73
47 0.81
48 0.84
49 0.87
50 0.88
51 0.89
52 0.88
53 0.83
54 0.75
55 0.64
56 0.57
57 0.47
58 0.37
59 0.27
60 0.18
61 0.13
62 0.12
63 0.14
64 0.11
65 0.12
66 0.15