Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZPG0

Protein Details
Accession A0A3A2ZPG0   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-122DTSCKRNQPKCVKKLVKHYKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto_nucl 6.5, cyto 6, nucl 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029033  His_PPase_superfam  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MICPLPLSIFMLFLTSLSITTATIHPTVYIIRHGEQSGDPDDHGLGPVGVKRAQCLRHVFGAGSPYNIGYIAAPKVKWNGDHRRPYETVLPLATDLGLTVDTSCKRNQPKCVKKLVKHYKDSGNILVSWRHGKLREIAMELGNRDPPEYPEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.08
4 0.08
5 0.08
6 0.07
7 0.09
8 0.1
9 0.11
10 0.12
11 0.12
12 0.11
13 0.12
14 0.13
15 0.12
16 0.15
17 0.15
18 0.16
19 0.18
20 0.18
21 0.19
22 0.18
23 0.21
24 0.2
25 0.19
26 0.17
27 0.15
28 0.16
29 0.14
30 0.13
31 0.1
32 0.06
33 0.06
34 0.08
35 0.09
36 0.11
37 0.11
38 0.13
39 0.18
40 0.2
41 0.25
42 0.28
43 0.29
44 0.29
45 0.3
46 0.28
47 0.24
48 0.26
49 0.21
50 0.17
51 0.14
52 0.12
53 0.11
54 0.11
55 0.1
56 0.05
57 0.06
58 0.07
59 0.08
60 0.08
61 0.09
62 0.11
63 0.12
64 0.16
65 0.22
66 0.31
67 0.38
68 0.47
69 0.48
70 0.52
71 0.52
72 0.51
73 0.49
74 0.4
75 0.33
76 0.25
77 0.23
78 0.17
79 0.16
80 0.13
81 0.07
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.07
88 0.09
89 0.11
90 0.12
91 0.19
92 0.27
93 0.33
94 0.43
95 0.51
96 0.6
97 0.66
98 0.76
99 0.78
100 0.76
101 0.82
102 0.83
103 0.81
104 0.77
105 0.76
106 0.73
107 0.7
108 0.68
109 0.6
110 0.51
111 0.43
112 0.39
113 0.34
114 0.29
115 0.27
116 0.25
117 0.25
118 0.24
119 0.26
120 0.3
121 0.35
122 0.36
123 0.36
124 0.36
125 0.35
126 0.37
127 0.36
128 0.32
129 0.29
130 0.26
131 0.23
132 0.22
133 0.21