Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z390

Protein Details
Accession A0A3A2Z390    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68KSNKKGGKSKSKRAQQQESDHydrophilic
NLS Segment(s)
PositionSequence
35-61AGGNKGKETPPPSAKSNKKGGKSKSKR
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
Amino Acid Sequences MKALIAWQPIPVMRARMRLRITCPVSLLKQPVKAAGGNKGKETPPPSAKSNKKGGKSKSKRAQQQESDVEAESDAEPSKGPSNVKDKILGYIES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.38
4 0.42
5 0.45
6 0.48
7 0.52
8 0.53
9 0.45
10 0.44
11 0.4
12 0.38
13 0.37
14 0.38
15 0.32
16 0.32
17 0.31
18 0.3
19 0.28
20 0.28
21 0.25
22 0.28
23 0.32
24 0.29
25 0.3
26 0.31
27 0.29
28 0.31
29 0.33
30 0.3
31 0.28
32 0.31
33 0.33
34 0.39
35 0.44
36 0.46
37 0.53
38 0.53
39 0.55
40 0.59
41 0.63
42 0.66
43 0.69
44 0.74
45 0.73
46 0.76
47 0.77
48 0.78
49 0.81
50 0.75
51 0.75
52 0.7
53 0.64
54 0.57
55 0.48
56 0.4
57 0.3
58 0.25
59 0.17
60 0.12
61 0.09
62 0.08
63 0.08
64 0.1
65 0.13
66 0.15
67 0.16
68 0.21
69 0.29
70 0.33
71 0.36
72 0.39
73 0.37
74 0.39