Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z229

Protein Details
Accession A0A3A2Z229   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
40-64KSQPGPKKPLSKTEKKKLKKKRSGCBasic
NLS Segment(s)
PositionSequence
36-62VVRQKSQPGPKKPLSKTEKKKLKKKRS
Subcellular Location(s) nucl 15, cyto_nucl 11.833, mito_nucl 11.499, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MGTNWVSFVEEAWRVLRGDGKGECWVSEVKSRFGRVVRQKSQPGPKKPLSKTEKKKLKKKRSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.19
4 0.15
5 0.19
6 0.18
7 0.2
8 0.21
9 0.21
10 0.21
11 0.18
12 0.18
13 0.15
14 0.21
15 0.2
16 0.21
17 0.23
18 0.24
19 0.24
20 0.25
21 0.32
22 0.36
23 0.44
24 0.45
25 0.5
26 0.55
27 0.6
28 0.69
29 0.7
30 0.68
31 0.67
32 0.69
33 0.72
34 0.7
35 0.73
36 0.71
37 0.73
38 0.75
39 0.78
40 0.81
41 0.81
42 0.88
43 0.89
44 0.92