Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZEL1

Protein Details
Accession A0A3A2ZEL1    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33IPTSADPRSRRPVKRRAVSPRSEHAHydrophilic
114-151QKKREETKRKDEEKTEKNRKRRDKRKAAKKNNAGKTGGBasic
NLS Segment(s)
PositionSequence
18-24RRPVKRR
115-148KKREETKRKDEEKTEKNRKRRDKRKAAKKNNAGK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPGPESIPTSADPRSRRPVKRRAVSPRSEHANQVDSLFRDPNKALKLPDASKPKTASSLPAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMQDEVHREKAEDEWQKKREETKRKDEEKTEKNRKRRDKRKAAKKNNAGKTGGLMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.44
4 0.52
5 0.6
6 0.66
7 0.72
8 0.76
9 0.82
10 0.84
11 0.85
12 0.85
13 0.83
14 0.81
15 0.78
16 0.76
17 0.68
18 0.61
19 0.53
20 0.47
21 0.4
22 0.35
23 0.3
24 0.23
25 0.24
26 0.24
27 0.21
28 0.2
29 0.2
30 0.24
31 0.25
32 0.26
33 0.25
34 0.26
35 0.32
36 0.31
37 0.38
38 0.41
39 0.4
40 0.42
41 0.43
42 0.39
43 0.37
44 0.35
45 0.31
46 0.27
47 0.31
48 0.29
49 0.29
50 0.28
51 0.24
52 0.24
53 0.21
54 0.17
55 0.11
56 0.1
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.03
64 0.03
65 0.02
66 0.03
67 0.04
68 0.05
69 0.04
70 0.05
71 0.06
72 0.06
73 0.11
74 0.19
75 0.26
76 0.31
77 0.35
78 0.41
79 0.5
80 0.58
81 0.63
82 0.64
83 0.61
84 0.57
85 0.55
86 0.5
87 0.44
88 0.4
89 0.39
90 0.33
91 0.33
92 0.31
93 0.3
94 0.3
95 0.28
96 0.33
97 0.33
98 0.36
99 0.4
100 0.44
101 0.46
102 0.48
103 0.55
104 0.56
105 0.58
106 0.62
107 0.64
108 0.71
109 0.75
110 0.79
111 0.79
112 0.8
113 0.79
114 0.81
115 0.82
116 0.8
117 0.83
118 0.87
119 0.89
120 0.9
121 0.91
122 0.91
123 0.91
124 0.93
125 0.95
126 0.96
127 0.96
128 0.96
129 0.95
130 0.94
131 0.92
132 0.88
133 0.79
134 0.68