Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZL82

Protein Details
Accession A0A3A2ZL82   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
180-199REGVRAFVEKRKPQWRPCKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR018376  Enoyl-CoA_hyd/isom_CS  
IPR001753  Enoyl-CoA_hydra/iso  
IPR014748  Enoyl-CoA_hydra_C  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00378  ECH_1  
PROSITE View protein in PROSITE  
PS00166  ENOYL_COA_HYDRATASE  
CDD cd06558  crotonase-like  
Amino Acid Sequences MSHAEWNQLNERGITNEMTAPGLAGLPRRKGEKPIIAAVNGYCLGGGFEMVVNCDIVIASERATFGLPEVRRGIAAVAGSLPRLVRIVGKQRAAEIALSGLTFSASQLEDWGLVNRVVEHNQLLATTVATASAISENSPDSLRVTMEGLHLGWEIASVEEASSALVDGWYRKLIEGENFREGVRAFVEKRKPQWRPCKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.18
4 0.18
5 0.17
6 0.15
7 0.13
8 0.11
9 0.1
10 0.1
11 0.14
12 0.18
13 0.22
14 0.25
15 0.29
16 0.31
17 0.36
18 0.44
19 0.46
20 0.46
21 0.49
22 0.49
23 0.44
24 0.44
25 0.38
26 0.32
27 0.24
28 0.19
29 0.11
30 0.09
31 0.08
32 0.07
33 0.07
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.04
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.07
53 0.14
54 0.13
55 0.15
56 0.17
57 0.17
58 0.16
59 0.17
60 0.16
61 0.1
62 0.1
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.1
74 0.19
75 0.24
76 0.26
77 0.26
78 0.26
79 0.27
80 0.26
81 0.22
82 0.13
83 0.08
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.03
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.09
130 0.09
131 0.1
132 0.1
133 0.1
134 0.11
135 0.09
136 0.09
137 0.09
138 0.08
139 0.07
140 0.06
141 0.06
142 0.05
143 0.06
144 0.05
145 0.04
146 0.05
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.06
155 0.09
156 0.11
157 0.11
158 0.11
159 0.13
160 0.16
161 0.23
162 0.3
163 0.33
164 0.35
165 0.36
166 0.35
167 0.36
168 0.34
169 0.28
170 0.22
171 0.23
172 0.22
173 0.3
174 0.4
175 0.44
176 0.53
177 0.62
178 0.68
179 0.73