Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z223

Protein Details
Accession A0A3A2Z223    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-99NKKAKKLTSSELRKKKKERMARRKRGEEVFSBasic
NLS Segment(s)
PositionSequence
68-94GNKKAKKLTSSELRKKKKERMARRKRG
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0003746  F:translation elongation factor activity  
Amino Acid Sequences EFEGGVVIISHNAEFTESLTEEVWSVMNGRMTPSGHNWIQGQGSGPRLSAKDDDEEEKFDAMGNKIEGNKKAKKLTSSELRKKKKERMARRKRGEEVFSDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.11
4 0.1
5 0.12
6 0.12
7 0.12
8 0.11
9 0.11
10 0.11
11 0.07
12 0.08
13 0.09
14 0.1
15 0.1
16 0.11
17 0.13
18 0.14
19 0.16
20 0.17
21 0.22
22 0.2
23 0.22
24 0.21
25 0.2
26 0.2
27 0.18
28 0.17
29 0.13
30 0.15
31 0.13
32 0.13
33 0.13
34 0.13
35 0.14
36 0.14
37 0.13
38 0.13
39 0.14
40 0.16
41 0.15
42 0.17
43 0.16
44 0.14
45 0.13
46 0.12
47 0.12
48 0.11
49 0.12
50 0.1
51 0.11
52 0.14
53 0.18
54 0.22
55 0.27
56 0.32
57 0.35
58 0.41
59 0.42
60 0.43
61 0.45
62 0.49
63 0.53
64 0.58
65 0.63
66 0.68
67 0.74
68 0.79
69 0.83
70 0.84
71 0.84
72 0.84
73 0.85
74 0.86
75 0.88
76 0.9
77 0.92
78 0.92
79 0.89
80 0.87
81 0.8
82 0.73
83 0.71