Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z8P5

Protein Details
Accession A0A3A2Z8P5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25PWETCDNPKHKQRRLQTANRFGSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, pero 4
Family & Domain DBs
Amino Acid Sequences MPWETCDNPKHKQRRLQTANRFGSDIIELADTLKTVLAQMVGELLAQAMEQSRSMGSNWQDQEAWDVSSLGIWADK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.84
4 0.84
5 0.85
6 0.83
7 0.75
8 0.66
9 0.55
10 0.46
11 0.36
12 0.25
13 0.15
14 0.1
15 0.08
16 0.08
17 0.08
18 0.06
19 0.05
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.02
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.07
42 0.12
43 0.14
44 0.21
45 0.22
46 0.24
47 0.24
48 0.23
49 0.27
50 0.24
51 0.22
52 0.15
53 0.14
54 0.12
55 0.12
56 0.12