Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NJR2

Protein Details
Accession B8NJR2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60KTPSCPKPSLLKLRMKQRGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR027179  MTCP1  
Pfam View protein in Pfam  
PF08991  MTCP1  
Amino Acid Sequences MPSTGSCLTKNSYQEEKCQNQINALYECCNAFYQAQGEDAKTPSCPKPSLLKLRMKQRGQGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.51
4 0.51
5 0.54
6 0.48
7 0.42
8 0.43
9 0.39
10 0.32
11 0.29
12 0.26
13 0.19
14 0.19
15 0.17
16 0.14
17 0.11
18 0.09
19 0.09
20 0.09
21 0.09
22 0.11
23 0.1
24 0.11
25 0.12
26 0.13
27 0.12
28 0.12
29 0.16
30 0.17
31 0.21
32 0.21
33 0.23
34 0.31
35 0.4
36 0.5
37 0.54
38 0.61
39 0.64
40 0.74
41 0.8
42 0.74