Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2ZLF4

Protein Details
Accession A0A3A2ZLF4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-72NSDGKITKPPRSNRGKSRRPGBasic
NLS Segment(s)
PositionSequence
46-72EGKPQRNSDGKITKPPRSNRGKSRRPG
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGSGKKEATRKERQSKGGDGMGNVKVKGENFYRDAKKLKTLNMYKEGKPQRNSDGKITKPPRSNRGKSRRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.68
4 0.63
5 0.53
6 0.44
7 0.41
8 0.37
9 0.33
10 0.27
11 0.23
12 0.18
13 0.18
14 0.2
15 0.18
16 0.17
17 0.18
18 0.25
19 0.27
20 0.3
21 0.33
22 0.31
23 0.35
24 0.34
25 0.35
26 0.38
27 0.4
28 0.43
29 0.48
30 0.51
31 0.45
32 0.52
33 0.57
34 0.56
35 0.55
36 0.53
37 0.53
38 0.57
39 0.59
40 0.59
41 0.58
42 0.54
43 0.61
44 0.64
45 0.64
46 0.64
47 0.68
48 0.69
49 0.71
50 0.77
51 0.77
52 0.82