Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZNL6

Protein Details
Accession A0A3A2ZNL6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
75-95QSEGASTKSKKQKKKDRFKPYHydrophilic
NLS Segment(s)
PositionSequence
82-94KSKKQKKKDRFKP
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011047  Quinoprotein_ADH-like_supfam  
IPR039328  WDR89  
Amino Acid Sequences MAEKRLDLVPLVQSSGPDWKFDFDRENLWRLPGAHGEEVVRSVYLDEQSKSVFTGGEDGFVRAWKPVDEKEGEPQSEGASTKSKKQKKKDRFKPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.23
4 0.2
5 0.2
6 0.21
7 0.23
8 0.25
9 0.27
10 0.2
11 0.27
12 0.29
13 0.32
14 0.29
15 0.28
16 0.28
17 0.24
18 0.25
19 0.21
20 0.21
21 0.18
22 0.18
23 0.17
24 0.16
25 0.15
26 0.13
27 0.1
28 0.06
29 0.06
30 0.06
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.07
40 0.06
41 0.1
42 0.09
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.13
49 0.09
50 0.1
51 0.08
52 0.11
53 0.13
54 0.18
55 0.21
56 0.22
57 0.3
58 0.35
59 0.34
60 0.32
61 0.3
62 0.26
63 0.25
64 0.24
65 0.18
66 0.2
67 0.21
68 0.3
69 0.4
70 0.48
71 0.55
72 0.65
73 0.74
74 0.77
75 0.87