Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2Z2I4

Protein Details
Accession A0A3A2Z2I4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-105ARDLRTRKSPKSKSPKNKSRIRCRRIRKTRPSPRRPNPGLKSTLBasic
NLS Segment(s)
PositionSequence
52-103KKKSSIPPPVARDLRTRKSPKSKSPKNKSRIRCRRIRKTRPSPRRPNPGLKS
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MKLTPKMKLTPKMKLTPKMKLTPKMKLIPKTIQLLTRLTMRASTLLTLCLPKKKSSIPPPVARDLRTRKSPKSKSPKNKSRIRCRRIRKTRPSPRRPNPGLKSTLKGLKPLSQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.73
4 0.75
5 0.74
6 0.75
7 0.75
8 0.73
9 0.72
10 0.73
11 0.72
12 0.71
13 0.68
14 0.66
15 0.63
16 0.61
17 0.58
18 0.52
19 0.47
20 0.42
21 0.37
22 0.32
23 0.3
24 0.26
25 0.2
26 0.19
27 0.16
28 0.15
29 0.13
30 0.13
31 0.09
32 0.09
33 0.1
34 0.12
35 0.13
36 0.17
37 0.18
38 0.19
39 0.21
40 0.25
41 0.32
42 0.39
43 0.48
44 0.49
45 0.54
46 0.57
47 0.62
48 0.59
49 0.53
50 0.52
51 0.49
52 0.48
53 0.5
54 0.52
55 0.52
56 0.61
57 0.67
58 0.69
59 0.73
60 0.78
61 0.8
62 0.86
63 0.88
64 0.86
65 0.88
66 0.88
67 0.89
68 0.89
69 0.86
70 0.85
71 0.86
72 0.88
73 0.9
74 0.91
75 0.9
76 0.9
77 0.94
78 0.95
79 0.95
80 0.95
81 0.94
82 0.94
83 0.9
84 0.9
85 0.86
86 0.83
87 0.8
88 0.73
89 0.67
90 0.63
91 0.63
92 0.54
93 0.52
94 0.47