Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZT59

Protein Details
Accession A0A3A2ZT59   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
225-288VDPAARSSPKSRKKPGKKRRAQLRKRASVAEKKKQSEAEKRNRKNRERKIKRRQKAREMKAASVBasic
NLS Segment(s)
PositionSequence
230-282RSSPKSRKKPGKKRRAQLRKRASVAEKKKQSEAEKRNRKNRERKIKRRQKARE
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFEVPNAKRVCRGDIDYRSSSPPSSPPCPETEFQDGRERLRKLLNLDDVFTTAPPIPAKESADEPGKDDKQDEDEEQEFEFRLFNSSTRKPEKRNDGPAATGISESTQRNTNGQAQKLRIKLRSPTPGPVDPSEGRFVRPFRGWEYYFTTPDLLSSSLSAPKPAQESLNTEKRKQFEDAAVSGLELMGWANKPWPGCHLPWRVIHLKARDTKGIPESKSAPIYVVDPAARSSPKSRKKPGKKRRAQLRKRASVAEKKKQSEAEKRNRKNRERKIKRRQKAREMKAASVVQEDASNIPIETGEGSLEGGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.56
4 0.56
5 0.54
6 0.5
7 0.46
8 0.38
9 0.37
10 0.37
11 0.39
12 0.41
13 0.4
14 0.43
15 0.47
16 0.45
17 0.44
18 0.47
19 0.43
20 0.42
21 0.49
22 0.45
23 0.46
24 0.53
25 0.49
26 0.43
27 0.46
28 0.47
29 0.41
30 0.47
31 0.5
32 0.43
33 0.43
34 0.41
35 0.36
36 0.32
37 0.27
38 0.22
39 0.13
40 0.15
41 0.14
42 0.14
43 0.16
44 0.19
45 0.21
46 0.2
47 0.22
48 0.24
49 0.29
50 0.28
51 0.28
52 0.34
53 0.33
54 0.32
55 0.31
56 0.28
57 0.26
58 0.29
59 0.27
60 0.24
61 0.24
62 0.24
63 0.24
64 0.22
65 0.18
66 0.15
67 0.14
68 0.09
69 0.11
70 0.1
71 0.12
72 0.19
73 0.24
74 0.32
75 0.41
76 0.46
77 0.49
78 0.57
79 0.65
80 0.67
81 0.71
82 0.7
83 0.63
84 0.58
85 0.54
86 0.47
87 0.37
88 0.28
89 0.18
90 0.13
91 0.14
92 0.13
93 0.13
94 0.16
95 0.16
96 0.17
97 0.2
98 0.28
99 0.29
100 0.33
101 0.36
102 0.36
103 0.41
104 0.45
105 0.47
106 0.42
107 0.4
108 0.41
109 0.43
110 0.48
111 0.45
112 0.45
113 0.45
114 0.45
115 0.45
116 0.41
117 0.4
118 0.32
119 0.31
120 0.31
121 0.25
122 0.24
123 0.23
124 0.23
125 0.21
126 0.22
127 0.22
128 0.21
129 0.27
130 0.26
131 0.26
132 0.32
133 0.31
134 0.3
135 0.29
136 0.26
137 0.19
138 0.19
139 0.17
140 0.1
141 0.07
142 0.07
143 0.08
144 0.11
145 0.11
146 0.12
147 0.11
148 0.12
149 0.14
150 0.14
151 0.14
152 0.12
153 0.18
154 0.23
155 0.32
156 0.32
157 0.33
158 0.36
159 0.36
160 0.38
161 0.34
162 0.3
163 0.25
164 0.27
165 0.25
166 0.23
167 0.21
168 0.18
169 0.16
170 0.13
171 0.09
172 0.05
173 0.04
174 0.03
175 0.04
176 0.04
177 0.05
178 0.07
179 0.08
180 0.08
181 0.14
182 0.16
183 0.18
184 0.27
185 0.32
186 0.35
187 0.36
188 0.42
189 0.41
190 0.41
191 0.44
192 0.4
193 0.41
194 0.44
195 0.44
196 0.43
197 0.4
198 0.41
199 0.43
200 0.44
201 0.38
202 0.36
203 0.36
204 0.36
205 0.36
206 0.32
207 0.25
208 0.2
209 0.2
210 0.17
211 0.16
212 0.12
213 0.11
214 0.12
215 0.14
216 0.14
217 0.16
218 0.22
219 0.3
220 0.4
221 0.49
222 0.58
223 0.66
224 0.77
225 0.86
226 0.9
227 0.91
228 0.91
229 0.93
230 0.94
231 0.94
232 0.93
233 0.92
234 0.92
235 0.91
236 0.84
237 0.82
238 0.79
239 0.78
240 0.78
241 0.77
242 0.75
243 0.69
244 0.7
245 0.69
246 0.69
247 0.7
248 0.71
249 0.71
250 0.74
251 0.8
252 0.85
253 0.89
254 0.91
255 0.91
256 0.91
257 0.91
258 0.92
259 0.93
260 0.95
261 0.95
262 0.94
263 0.95
264 0.94
265 0.94
266 0.94
267 0.91
268 0.91
269 0.85
270 0.79
271 0.76
272 0.68
273 0.58
274 0.49
275 0.41
276 0.3
277 0.25
278 0.23
279 0.15
280 0.14
281 0.13
282 0.11
283 0.1
284 0.09
285 0.09
286 0.09
287 0.08
288 0.07
289 0.07
290 0.07