Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZGI7

Protein Details
Accession A0A3A2ZGI7   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-36LERNRVAALKCRQRKKQWLANLQAKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito 6.5, cyto_mito 6.166, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MTDEEKRRNFLERNRVAALKCRQRKKQWLANLQAKVEMYSAENDSLNTQVAQLHDEIRNLRTLLMGHKDCPVGHAQGIGQFLSGMQDPNAFGNQHVNPYGMALPNGAPLQPGMQRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.53
4 0.55
5 0.56
6 0.55
7 0.58
8 0.61
9 0.66
10 0.73
11 0.82
12 0.83
13 0.82
14 0.82
15 0.82
16 0.82
17 0.82
18 0.76
19 0.66
20 0.59
21 0.49
22 0.4
23 0.3
24 0.21
25 0.14
26 0.11
27 0.12
28 0.11
29 0.11
30 0.1
31 0.1
32 0.1
33 0.1
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.1
41 0.1
42 0.12
43 0.13
44 0.12
45 0.13
46 0.12
47 0.12
48 0.1
49 0.1
50 0.11
51 0.17
52 0.17
53 0.16
54 0.18
55 0.19
56 0.18
57 0.2
58 0.19
59 0.14
60 0.13
61 0.13
62 0.11
63 0.13
64 0.14
65 0.12
66 0.1
67 0.08
68 0.08
69 0.09
70 0.09
71 0.07
72 0.06
73 0.07
74 0.08
75 0.1
76 0.12
77 0.11
78 0.11
79 0.16
80 0.17
81 0.2
82 0.2
83 0.19
84 0.17
85 0.19
86 0.21
87 0.15
88 0.15
89 0.12
90 0.12
91 0.14
92 0.15
93 0.13
94 0.11
95 0.1
96 0.14