Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N7S1

Protein Details
Accession B8N7S1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-98DGKLHDAYKKCKRNKCRANQGYYPESHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, E.R. 3, mito 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MIKTILCALAILAAIAPLTTAEKIKCNNATAYCGATLINRGGYLTQISEILKNHDEDAGGLLLQHGLFWCKEDGKLHDAYKKCKRNKCRANQGYYPESGDECKGEWRGSILPDMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.03
5 0.05
6 0.06
7 0.08
8 0.1
9 0.14
10 0.17
11 0.22
12 0.25
13 0.26
14 0.3
15 0.29
16 0.32
17 0.29
18 0.28
19 0.23
20 0.2
21 0.17
22 0.14
23 0.14
24 0.1
25 0.1
26 0.08
27 0.08
28 0.07
29 0.08
30 0.08
31 0.07
32 0.06
33 0.07
34 0.07
35 0.09
36 0.1
37 0.12
38 0.13
39 0.13
40 0.13
41 0.12
42 0.12
43 0.1
44 0.11
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.06
56 0.07
57 0.08
58 0.09
59 0.12
60 0.15
61 0.18
62 0.23
63 0.24
64 0.29
65 0.32
66 0.39
67 0.47
68 0.53
69 0.58
70 0.63
71 0.7
72 0.76
73 0.83
74 0.85
75 0.87
76 0.86
77 0.86
78 0.83
79 0.81
80 0.74
81 0.65
82 0.56
83 0.45
84 0.37
85 0.31
86 0.25
87 0.19
88 0.16
89 0.19
90 0.2
91 0.19
92 0.18
93 0.2
94 0.22
95 0.23