Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z193

Protein Details
Accession A0A3A2Z193    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAAGRKSPKWFRQVSRCPRQRRAARPRTWHQVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito_nucl 10, mito 8.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MAAGRKSPKWFRQVSRCPRQRRAARPRTWHQVVKGEEESRGESLRFVWVERFSKVAKDDLFLAKNNIIAANAKLAGNEYICGYAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.85
5 0.85
6 0.86
7 0.85
8 0.85
9 0.85
10 0.85
11 0.84
12 0.84
13 0.83
14 0.82
15 0.79
16 0.72
17 0.64
18 0.61
19 0.54
20 0.51
21 0.47
22 0.38
23 0.33
24 0.3
25 0.28
26 0.21
27 0.19
28 0.14
29 0.1
30 0.1
31 0.12
32 0.11
33 0.1
34 0.11
35 0.15
36 0.17
37 0.17
38 0.19
39 0.16
40 0.19
41 0.2
42 0.22
43 0.18
44 0.18
45 0.2
46 0.23
47 0.25
48 0.23
49 0.24
50 0.2
51 0.21
52 0.2
53 0.17
54 0.13
55 0.13
56 0.13
57 0.13
58 0.13
59 0.12
60 0.12
61 0.13
62 0.14
63 0.13
64 0.13
65 0.11