Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2Z7I9

Protein Details
Accession A0A3A2Z7I9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25VRVRSRVKSIPQTRRKYLSRHydrophilic
NLS Segment(s)
PositionSequence
81-119ADSRSGSKGRKSRSGSLTPDRAKSSRPGSAGRRRVSGRG
Subcellular Location(s) mito 14.5, cyto_mito 10.166, nucl 8, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MANIYVRVRSRVKSIPQTRRKYLSRLLAPEDSDAEREIRGDVFVLQFPGADRDGGRMTPMAVRRGVVDVHEDGDGGWIKRADSRSGSKGRKSRSGSLTPDRAKSSRPGSAGRRRVSGRGVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.73
4 0.79
5 0.8
6 0.8
7 0.76
8 0.71
9 0.69
10 0.67
11 0.64
12 0.6
13 0.59
14 0.53
15 0.5
16 0.45
17 0.4
18 0.31
19 0.24
20 0.2
21 0.16
22 0.12
23 0.12
24 0.11
25 0.09
26 0.08
27 0.07
28 0.07
29 0.08
30 0.08
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.08
38 0.07
39 0.09
40 0.1
41 0.1
42 0.1
43 0.08
44 0.08
45 0.11
46 0.14
47 0.13
48 0.13
49 0.13
50 0.13
51 0.14
52 0.13
53 0.1
54 0.11
55 0.09
56 0.1
57 0.1
58 0.09
59 0.08
60 0.1
61 0.11
62 0.09
63 0.1
64 0.09
65 0.09
66 0.13
67 0.15
68 0.15
69 0.19
70 0.24
71 0.3
72 0.39
73 0.44
74 0.48
75 0.52
76 0.55
77 0.59
78 0.61
79 0.62
80 0.6
81 0.63
82 0.63
83 0.65
84 0.69
85 0.64
86 0.62
87 0.59
88 0.52
89 0.47
90 0.47
91 0.45
92 0.41
93 0.41
94 0.44
95 0.48
96 0.58
97 0.64
98 0.61
99 0.62
100 0.6
101 0.6