Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZEN1

Protein Details
Accession A0A3A2ZEN1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27LTLRRRICSCQKGRQTPRRDRNSRVSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences LTLRRRICSCQKGRQTPRRDRNSRVSEGIWHRHLCHADFRHPAWPESSGGRRPDRNRRFGSGSRDTGREMRRPADRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.89
5 0.9
6 0.86
7 0.82
8 0.82
9 0.8
10 0.74
11 0.66
12 0.57
13 0.53
14 0.53
15 0.52
16 0.45
17 0.38
18 0.35
19 0.35
20 0.35
21 0.29
22 0.31
23 0.28
24 0.29
25 0.31
26 0.31
27 0.33
28 0.33
29 0.32
30 0.26
31 0.24
32 0.2
33 0.22
34 0.25
35 0.24
36 0.28
37 0.33
38 0.39
39 0.44
40 0.54
41 0.59
42 0.63
43 0.63
44 0.64
45 0.67
46 0.66
47 0.67
48 0.64
49 0.63
50 0.57
51 0.54
52 0.51
53 0.51
54 0.5
55 0.49
56 0.45
57 0.44