Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z1T2

Protein Details
Accession A0A3A2Z1T2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-81IVAGLEKKRQKRKEKYWRQHCRKAAKEQAHydrophilic
NLS Segment(s)
PositionSequence
59-91KKRQKRKEKYWRQHCRKAAKEQAERKPVPGRGA
Subcellular Location(s) mito 10, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018853  DUF2457  
Pfam View protein in Pfam  
PF10446  DUF2457  
Amino Acid Sequences MERTASLPDTPNPFFKNFHIGSPSISNIASGAVTPAVEEPPRPDMHVRGPVDIVAGLEKKRQKRKEKYWRQHCRKAAKEQAERKPVPGRGAERMKELGLECAERTKGYGIGQQTQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.39
4 0.34
5 0.35
6 0.33
7 0.3
8 0.31
9 0.31
10 0.3
11 0.22
12 0.21
13 0.18
14 0.14
15 0.13
16 0.1
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.13
28 0.14
29 0.15
30 0.16
31 0.17
32 0.22
33 0.3
34 0.28
35 0.25
36 0.25
37 0.23
38 0.22
39 0.2
40 0.14
41 0.07
42 0.08
43 0.07
44 0.11
45 0.15
46 0.22
47 0.31
48 0.4
49 0.5
50 0.59
51 0.7
52 0.77
53 0.85
54 0.89
55 0.91
56 0.94
57 0.92
58 0.92
59 0.88
60 0.87
61 0.82
62 0.81
63 0.79
64 0.78
65 0.78
66 0.78
67 0.79
68 0.78
69 0.72
70 0.66
71 0.64
72 0.57
73 0.51
74 0.48
75 0.43
76 0.42
77 0.49
78 0.47
79 0.43
80 0.42
81 0.39
82 0.35
83 0.32
84 0.27
85 0.21
86 0.22
87 0.18
88 0.21
89 0.21
90 0.19
91 0.2
92 0.18
93 0.18
94 0.19
95 0.23
96 0.23