Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z1J8

Protein Details
Accession A0A3A2Z1J8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
78-100QYQAYKPRSRPGRRRHTGSSTMGHydrophilic
NLS Segment(s)
PositionSequence
87-91RPGRR
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016039  Thiolase-like  
Gene Ontology GO:0016746  F:acyltransferase activity  
Amino Acid Sequences MFNGCLQVLDSGLVPGNRNADNVDKALEKFDYIVYPSRSIQTDGVKAFSVTSFGFGQKGAQVIGIHPKYLYATLDAAQYQAYKPRSRPGRRRHTGSSTMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.16
5 0.16
6 0.17
7 0.19
8 0.2
9 0.2
10 0.2
11 0.18
12 0.18
13 0.2
14 0.18
15 0.14
16 0.12
17 0.13
18 0.11
19 0.11
20 0.16
21 0.16
22 0.18
23 0.19
24 0.2
25 0.2
26 0.21
27 0.22
28 0.2
29 0.22
30 0.2
31 0.21
32 0.19
33 0.17
34 0.16
35 0.13
36 0.11
37 0.07
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.06
47 0.07
48 0.07
49 0.08
50 0.17
51 0.16
52 0.16
53 0.15
54 0.15
55 0.15
56 0.16
57 0.16
58 0.09
59 0.1
60 0.1
61 0.12
62 0.12
63 0.11
64 0.11
65 0.11
66 0.1
67 0.16
68 0.2
69 0.23
70 0.25
71 0.34
72 0.44
73 0.54
74 0.64
75 0.68
76 0.75
77 0.8
78 0.86
79 0.85
80 0.83