Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z8A1

Protein Details
Accession A0A3A2Z8A1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31LRPTVRRFSARRPKPNSRASRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 5, E.R. 3
Family & Domain DBs
Amino Acid Sequences MALALANPLLRPTVRRFSARRPKPNSRASRVVAMSCIVSAVVLPFVPPALESSRERNLGYPNHNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.4
4 0.5
5 0.6
6 0.67
7 0.71
8 0.71
9 0.78
10 0.8
11 0.86
12 0.83
13 0.79
14 0.76
15 0.68
16 0.65
17 0.56
18 0.47
19 0.37
20 0.29
21 0.22
22 0.15
23 0.12
24 0.06
25 0.04
26 0.04
27 0.04
28 0.04
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.07
36 0.09
37 0.14
38 0.16
39 0.22
40 0.28
41 0.31
42 0.31
43 0.32
44 0.36
45 0.39