Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z520

Protein Details
Accession A0A3A2Z520    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
178-199IEKGRLQQQQKKLDQKRAKLDWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, extr 6, cyto_nucl 5.5, pero 3, E.R. 3, nucl 2.5, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015876  Acyl-CoA_DS  
IPR005804  FA_desaturase_dom  
IPR001522  FADS-1_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0046872  F:metal ion binding  
GO:0016717  F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF00487  FA_desaturase  
PROSITE View protein in PROSITE  
PS00476  FATTY_ACID_DESATUR_1  
CDD cd03505  Delta9-FADS-like  
Amino Acid Sequences YTDTDKDPYSVRKGLLYSHIGWMVMKQNPKRIGRTDISDLNEDPIVVWQHKNYLKVVIFMGLILPTIVAGLGWGDWWGGFIYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNSPRDHVITAFVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWFIWTCKQLGLAYDLKQFRANEIEKGRLQQQQKKLDQKRAKLDWGVPLDQLPVMEWDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.37
4 0.32
5 0.32
6 0.31
7 0.28
8 0.27
9 0.26
10 0.25
11 0.25
12 0.31
13 0.31
14 0.38
15 0.46
16 0.51
17 0.54
18 0.52
19 0.56
20 0.52
21 0.55
22 0.52
23 0.5
24 0.49
25 0.46
26 0.41
27 0.36
28 0.31
29 0.25
30 0.19
31 0.16
32 0.16
33 0.15
34 0.15
35 0.14
36 0.21
37 0.24
38 0.26
39 0.24
40 0.28
41 0.27
42 0.28
43 0.28
44 0.21
45 0.18
46 0.16
47 0.15
48 0.08
49 0.08
50 0.06
51 0.05
52 0.03
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.11
88 0.1
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.08
96 0.09
97 0.1
98 0.13
99 0.13
100 0.15
101 0.19
102 0.2
103 0.19
104 0.19
105 0.18
106 0.17
107 0.18
108 0.16
109 0.12
110 0.11
111 0.1
112 0.09
113 0.08
114 0.07
115 0.05
116 0.05
117 0.06
118 0.06
119 0.09
120 0.1
121 0.1
122 0.11
123 0.12
124 0.15
125 0.16
126 0.21
127 0.19
128 0.19
129 0.19
130 0.19
131 0.2
132 0.18
133 0.22
134 0.17
135 0.19
136 0.23
137 0.23
138 0.23
139 0.24
140 0.26
141 0.21
142 0.21
143 0.2
144 0.2
145 0.28
146 0.34
147 0.33
148 0.32
149 0.33
150 0.33
151 0.32
152 0.32
153 0.28
154 0.24
155 0.29
156 0.27
157 0.26
158 0.31
159 0.3
160 0.27
161 0.31
162 0.31
163 0.31
164 0.34
165 0.39
166 0.36
167 0.39
168 0.42
169 0.41
170 0.47
171 0.48
172 0.53
173 0.57
174 0.65
175 0.72
176 0.76
177 0.8
178 0.81
179 0.81
180 0.82
181 0.78
182 0.76
183 0.7
184 0.66
185 0.63
186 0.61
187 0.54
188 0.44
189 0.39
190 0.33
191 0.29
192 0.25
193 0.17
194 0.13