Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MW83

Protein Details
Accession B8MW83    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-55EVCRKACYSHKPKCPRHWHRKSDYYEDDCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, golg 4, mito 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKLSTITLVAASILLSGAAATPFESAEVCRKACYSHKPKCPRHWHRKSDYYEDDCGYDYEEFEWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.06
13 0.11
14 0.14
15 0.14
16 0.14
17 0.14
18 0.16
19 0.21
20 0.3
21 0.34
22 0.4
23 0.5
24 0.6
25 0.68
26 0.76
27 0.83
28 0.84
29 0.86
30 0.88
31 0.88
32 0.87
33 0.88
34 0.84
35 0.82
36 0.8
37 0.74
38 0.67
39 0.58
40 0.5
41 0.41
42 0.35
43 0.28
44 0.2
45 0.15