Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2Z2E5

Protein Details
Accession A0A3A2Z2E5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-34HFGPDAKHRRRVCQRRQSPASQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018314  Fmu/NOL1/Nop2p_CS  
IPR001678  MeTrfase_RsmB/NOP2  
IPR023267  RCMT  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
Pfam View protein in Pfam  
PF01189  Methyltr_RsmB-F  
PROSITE View protein in PROSITE  
PS01153  NOL1_NOP2_SUN  
PS51686  SAM_MT_RSMB_NOP  
Amino Acid Sequences YGCRARWKDDLHFGPDAKHRRRVCQRRQSPASQSLIGNIHRLGCKNTIVCNYDAQKAFPKVLGGFDRVLLDAPCSGTGVIGKDPSVKTSKNERDFLALPHLQKQLLLAAIDSTDHASKTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.53
4 0.49
5 0.53
6 0.5
7 0.56
8 0.67
9 0.73
10 0.76
11 0.77
12 0.81
13 0.82
14 0.87
15 0.83
16 0.79
17 0.76
18 0.69
19 0.6
20 0.51
21 0.43
22 0.4
23 0.34
24 0.28
25 0.21
26 0.19
27 0.18
28 0.19
29 0.18
30 0.17
31 0.19
32 0.18
33 0.21
34 0.23
35 0.24
36 0.24
37 0.26
38 0.26
39 0.28
40 0.27
41 0.25
42 0.26
43 0.25
44 0.24
45 0.2
46 0.19
47 0.14
48 0.16
49 0.16
50 0.13
51 0.12
52 0.13
53 0.13
54 0.12
55 0.12
56 0.09
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.12
70 0.13
71 0.16
72 0.19
73 0.18
74 0.22
75 0.32
76 0.42
77 0.44
78 0.47
79 0.45
80 0.47
81 0.47
82 0.45
83 0.42
84 0.36
85 0.31
86 0.34
87 0.35
88 0.29
89 0.28
90 0.26
91 0.21
92 0.19
93 0.18
94 0.12
95 0.11
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.11